KEGG   Streptomyces avermitilis: SAVERM_6664
Entry
SAVERM_6664       CDS       T00126                                 

Gene name
glpK1
Definition
(GenBank) putative glycerol kinase
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
sma  Streptomyces avermitilis
Pathway
sma00561  Glycerolipid metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SAVERM_6664 (glpK1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_6664 (glpK1)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SAVERM_6664 (glpK1)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAVERM_6664 (glpK1)
SSDB
Motif
Pfam: FGGY_N FGGY_C BcrAD_BadFG
Other DBs
NCBI-ProteinID: BAC74375
NITE: SAV6664
UniProt: Q828K5
Position
complement(7970359..7971897)
AA seq 512 aa
MTDAHTAGPFIAAIDQGTTSSRCIVFDRDGRIVSVDQKEHEQIFPKPGWVEHNAAEIWTN
VQEVVAGAVEKAGITRDDIKAIGITNQRETTLLWDKNTGEPVHNALVWQDTRTDALCKEL
GRNVGQDRFRRETGLPLASYFAGPKARWLLDNVEGLRERAEAGDILFGTMDTWVIWNLTG
GVNGGKHVTDVTNASRTMLMNLHTMQWDDKIAESIGVPLAMLPEIRSSAEVYGEITGGKL
GDLLGGIPVASALGDQQAALFGQTCFSEGEAKSTYGTGTFMLMNTGDKIINSYSGLLTTV
GYQIGDQKPVYALEGSIAVTGSLVQWMRDQMGLIKSAAEIETLASSVEDNGGAYFVPAFS
GLFAPYWRSDARGVIAGLTRYVTKAHIARAVLEATAWQTREITDAMTKDSGVELAALKVD
GGMTSNNLLMQTLSDFLDAPVVRPMVAETTCLGAAYAAGLAVGFWTNTEDLRANWRRAAE
WTPNMAAETRDREYKSWLKAVERTMGWIEDEE
NT seq 1539 nt   +upstreamnt  +downstreamnt
gtgaccgacgcacacaccgccggccccttcatcgccgcgatcgaccagggcaccacgtcc
agccgttgcatcgtcttcgaccgggacggccgtatcgtctccgtcgaccagaaggagcac
gagcagatcttcccgaagccgggctgggtcgagcacaacgccgccgagatctggaccaac
gtccaggaggtcgtcgccggagccgtcgagaaggccggcatcacccgcgacgacatcaag
gccatcggcatcaccaaccagcgcgagaccacgctgctctgggacaagaacaccggtgag
cccgtccacaacgccctcgtctggcaggacacccgcaccgacgcgctctgcaaggaactc
ggccgcaacgtcggccaggaccgcttccgccgcgagaccggcctgccgctcgcgtcgtac
ttcgccggcccgaaggcccgctggctgctggacaacgtcgagggcctgcgcgagcgcgcc
gaagccggcgacatcctcttcggcaccatggacacctgggtcatctggaacctgacgggt
ggtgtcaacggcggcaagcacgtcaccgacgtcaccaacgcctcccgcaccatgctgatg
aacctgcacaccatgcagtgggacgacaagatcgccgagtccatcggtgtcccgctggcg
atgctgcccgagatccgctcctccgccgaggtgtacggcgagatcaccggcggcaagctc
ggcgacctgctcggcggcatccccgtcgcctccgcgctcggcgaccagcaggcggccctg
ttcggccagacctgtttctccgagggcgaggccaagtccacgtacggcaccggcacgttc
atgctgatgaacaccggtgacaagatcatcaactcgtacagcgggctgctgaccaccgtg
ggctaccagatcggcgaccagaagccggtctacgccctcgagggttccatcgccgtcacc
ggttcgctcgtgcagtggatgcgcgaccagatgggcctgatcaagtccgccgccgagatc
gagacgctcgcgtcgtcggtcgaggacaacggcggcgcctacttcgtgccggccttctcc
ggtctgttcgccccgtactggcgctccgacgcccgcggtgtgatcgccggtctcacccgg
tacgtcaccaaggcgcacatcgcgcgcgccgtcctggaggccacggcctggcagacccgc
gagatcaccgacgccatgacgaaggactccggcgtcgagctcgcggccctcaaggtcgac
ggcggcatgacctccaacaacctgctgatgcagacgctctcggacttcctggacgcgccg
gtggtgcgtccgatggtcgccgagaccacctgcctcggcgccgcctacgccgccggtctc
gccgtcggcttctggaccaacaccgaggacctgcgggccaactggcgcagggccgcggag
tggaccccgaacatggccgcggagacccgcgaccgtgagtacaagagctggctcaaggcc
gtcgagcggaccatgggctggatcgaggacgaggagtaa

KEGG   Streptomyces avermitilis: SAVERM_6963
Entry
SAVERM_6963       CDS       T00126                                 

Gene name
glpK2
Definition
(GenBank) putative glycerol kinase
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
sma  Streptomyces avermitilis
Pathway
sma00561  Glycerolipid metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SAVERM_6963 (glpK2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_6963 (glpK2)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SAVERM_6963 (glpK2)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAVERM_6963 (glpK2)
SSDB
Motif
Pfam: FGGY_N FGGY_C
Other DBs
NCBI-ProteinID: BAC74674
NITE: SAV6963
UniProt: Q827G1
Position
complement(8310646..8312169)
AA seq 507 aa
MPDNAQKYVAAIDQGTTSSRCIIFDHGGAIVAVDQREHRQIFPKPGWVEHDATEIWSKVQ
AVVAGAIAKAGLRADQLSALGITNQRETTVLWDRATGKPVHNAIVWQDTRTSALCHELGG
SDGQDRFREQTGLPLASYFSGPKAAWLLDNVPGLRARAERGEIAFGTIDSWLIWNLTGGT
DGGRHVTDVTNAGRTMLMNLETLQWDRSILSAMNVPEAVLPEIRSSSEVYGTAVGQLSGV
PVASALGDQQAAVFGQACYDVGTAKNTYGTGSFLLLNTGNRPVPSKNGLLTTMGYKIGGE
APVYCLEGSIAITGALVQWFRDQLGIIRTADEIETLAASVDDNGGAYIVPAFSGLFAPYW
RSDARGVVTGLTRYVTKAHLARAVLEATSWQTREVVDAMYQDSGVRITTLKVDGGMTKNN
LLMQHQADVLGVPVIRPRVSETTCLGAAYAAGLATGVWNDLDELKSHWQKDVEWTPSMEA
SERDREYHNWRKAVEKSFGWHEEDGVN
NT seq 1524 nt   +upstreamnt  +downstreamnt
atgccggacaacgcccagaagtacgtcgccgccatcgaccagggcaccacctcgagccgc
tgcatcatcttcgaccacggcggcgcgatcgtcgccgtcgaccagcgtgaacaccgccag
atcttccccaagcccggctgggtggagcacgacgccaccgagatctggtccaaggtgcag
gcggtggtcgcgggggcgatcgccaaggccggactgcgcgccgaccagctcagcgcgctc
ggcatcaccaaccagcgcgagacgacggtcctgtgggaccgcgccaccggcaagcccgtg
cacaacgcgatcgtgtggcaggacacgcgtacgtccgcgctctgccacgaattgggcggc
tcggacgggcaggaccgtttccgcgagcagaccgggctgccgctggccagctacttctcc
gggcccaaggcggcctggctgctcgacaacgtgcctgggctcagggcccgtgccgagcgc
ggcgagatcgccttcggcaccatcgactcctggctcatctggaacctcacgggcggcacg
gacggcggccggcacgtcaccgatgtgaccaacgcaggccgcacgatgctgatgaacctg
gagacgctccagtgggaccgttccatcctgtccgcgatgaacgtccccgaggcggtcctc
cccgagatcaggtcctcgtccgaggtgtacgggacggccgtgggccagctttcgggcgtg
cccgtcgcgtcggcgctcggcgaccagcaggcggccgtgttcggacaggcctgctacgac
gtgggtacggcgaagaacacctacggcacgggcagcttcctgctgctcaacaccggcaac
cggcccgtgccgtcgaagaacggcctgctgacgaccatgggctacaagatcggtggcgag
gcgccggtctactgcctcgaagggtcgatcgcgatcacgggcgcgctggtgcagtggttc
cgcgaccaactcggcatcatccgtacggcggacgagatcgagacccttgcggcgagcgtc
gacgacaacggcggggcgtacatcgtgcccgcgttctccggcctgttcgcgccgtactgg
cgctccgacgcacgcggtgtcgtcaccggcctcacccggtacgtcacgaaggcacacctg
gcgcgcgcggtactggaggccacgagctggcagacgcgtgaggtcgtcgacgccatgtac
caggactccggggtgcggatcaccaccctgaaggtcgacggcggcatgaccaagaacaat
ctgctgatgcagcaccaggcggatgtgctcggcgtgccggtcatccgccccagggtctcc
gagaccacctgcctgggcgccgcctacgcggccgggctcgcgaccggcgtgtggaacgac
ctcgacgagctgaagtcgcactggcagaaggacgtcgagtggacgccctccatggaggcg
tcggagcgcgaccgcgagtaccacaactggcgcaaggcggtggagaagagcttcggctgg
cacgaggaggacggcgtgaactga

KEGG   Streptomyces avermitilis: SAVERM_7201
Entry
SAVERM_7201       CDS       T00126                                 

Gene name
glpK3
Definition
(GenBank) putative glycerol kinase
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
sma  Streptomyces avermitilis
Pathway
sma00561  Glycerolipid metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SAVERM_7201 (glpK3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_7201 (glpK3)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SAVERM_7201 (glpK3)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAVERM_7201 (glpK3)
SSDB
Motif
Pfam: FGGY_N FGGY_C
Other DBs
NCBI-ProteinID: BAC74912
NITE: SAV7201
UniProt: Q826J2
Position
8575186..8576703
AA seq 505 aa
MADFVGAVDQGTTSTRFMIFDHAGNEVAKHQLEHAQILPRSGWVEHDPVEIWERTNSVIQ
NALRHGNLSPDDLAAIGITNQRETTVVWDPRNGRPYYNAIVWQDTRTDSIAAALERSGQG
DVIRRKAGLPPATYFSGGKIQWILENVDGVREAAEQGHAVFGNTDCWVLWNLTGGPDGGI
HATDVTNASRTMLMDLETLDWDDELLGLFDIPRSMLPTINPSSHPEAYGQTRTSRPLRAA
IPIAGVLGDQQAATVGQVCYAPGEAKNTYGTGNFLVLNTGTELVRSQHGLLTTVAYQFGD
SPAIYALEGSIAVTGSAVQWLRDQMKIIKSAAESETLARTVEDNGGIYFVPAFSGLFAPY
WRSDARGAIVGLARYHDNGHLARATLEAICYQSRDVVEAMEQDSGVHLDVLKVDGGVTAN
DLCMQIQADILGVPVSRPVVAETTALGAAYAAGLATGFWQDTDELRTHWQESKRWEPQWS
EDRRAEGYAGWKKAVERTLDWSKVE
NT seq 1518 nt   +upstreamnt  +downstreamnt
atggcggacttcgtcggcgcggtggaccaggggaccaccagcacccgattcatgatcttc
gaccacgccggcaacgaggtggcgaagcaccagctggagcacgcccagatccttccgcgc
tccgggtgggtcgagcacgacccggtggagatctgggaacgcaccaactcggtgatacag
aacgccctgcggcacgggaacctgtccccggacgacctggcggcgatcggcatcaccaac
caacgggagaccaccgtcgtctgggacccgcgcaacggccgtccctactacaacgccatc
gtctggcaggacacccgcaccgactccatcgccgcggccctggaacgctcgggccagggc
gacgtcatccgccgcaaggcggggctgccgccggcgacctacttctccggcggcaagatc
cagtggatcctggagaacgtcgacggcgtccgcgaggcagccgagcaggggcacgccgtc
ttcggcaacacggactgctgggtcctgtggaacctgaccggcggccccgacggcggcatc
cacgccaccgacgtgaccaacgccagccgcaccatgctgatggacctggaaaccctcgac
tgggacgacgaactgctgggactcttcgacatcccgcgatcgatgctgcccaccatcaac
ccgtcctcccacccggaggcctacggccagacccgtacctcccggccgctgcgcgccgcc
atccccatcgccggggtactcggcgaccagcaggcggccaccgtcggacaggtctgctac
gcgcccggcgaagccaagaacacctacggcacgggcaacttcctggtgctgaacaccggc
accgaactggtccgctcccagcacggactcctcaccaccgtggcctaccagttcggcgac
agcccggccatctacgccctggagggctccatcgccgtcaccgggtccgcggtgcaatgg
ctgcgcgaccagatgaagatcatcaagtccgcggccgagagcgagacgctggcgcgtacc
gtcgaggacaacggcggcatctacttcgtccccgcgttctcgggcctgttcgccccgtac
tggcgctccgacgcccgcggcgcgatcgtcggcctcgcccggtaccacgacaacggtcac
ctggcccgcgcgacgctggaagccatctgctatcagagccgtgacgtcgtcgaggccatg
gagcaggactccggagtccacctcgatgtgctcaaggtcgacggcggcgtgaccgccaac
gacctgtgcatgcagatccaggccgacatcctcggcgtaccggtcagccgcccggtcgtc
gccgagaccaccgcgctcggcgccgcctacgcggcgggtctggccaccggcttctggcag
gacaccgacgaactgcgcacccactggcaggagtccaagcgctgggagccccagtggtcc
gaggaccggcgggcggagggctacgcgggctggaagaaggcggtggagcgcacgctcgac
tggtccaaggtggaatag

DBGET integrated database retrieval system