KEGG   Streptomyces avermitilis: SAVERM_6667Help
Entry
SAVERM_6667       CDS       T00126                                 

Gene name
metH
Definition
(GenBank) putative 5-methyltetrahydrofolate:homocysteine S-methyltransferase
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
sma  Streptomyces avermitilis
Pathway
sma00270  Cysteine and methionine metabolism
sma00450  Selenocompound metabolism
sma00670  One carbon pool by folate
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SAVERM_6667 (metH)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SAVERM_6667 (metH)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SAVERM_6667 (metH)
Enzymes [BR:sma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     SAVERM_6667 (metH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-methyl_trans Pterin_bind Met_synt_B12 B12-binding_2 B12-binding CdhD Tautomerase_2
Motif
Other DBs
NCBI-ProteinID: BAC74378
NITE: SAV6667
UniProt: Q828K2
Position
7974140..7977712
Genome map
AA seq 1190 aa AA seqDB search
MGSAKPTAVALQGASSMASLPNPSPSSASAASRSRTDALREALATRVVVADGAMGTMLQA
QDPTLEDFENLEGCNEILNLTRPDIVRSVHEAYFAVGVDCVETNTFGANHSALAEYDIAD
RVFELSEAGARLAREVADEFGTGDGRQRWVLGSIGPGTKLPTLGHVGYGTLRDGFQANAE
GLIAGGADALIVETTQDLLQTKTSVLGARRAMDATGVDLPLLVSMAFETTGTMLLGSEIG
AALTALEPLGIDMIGLNCSTGPAEMSEHLRYLTRHSRIPLLCMPNAGLPVLTKDGAHFPL
GPEGLADAQENFVRDYGLSLVGGCCGTTPEHLRQLVERVRGVEPTERRPQPEPGAASLYQ
TVPFRQDTAYMAIGERTNANGSKKFREAMLDARWDDCVEMARDQIREGAHMLDLCVDYVG
RDGVADMEELAGRFATASTLPIVLDSTEVDVLRAGLEKLGGRAVINSVNYEDGDGPESRF
AKVTRLAQEHGAALIALTIDEEGQARTVETKVAIAERLIEDLTTNWGIHESDILMDCLTF
TICTGQEESRGDGIATIEAIRELKRRRPDVQTTLGLSNISFGLNPAARILLNSVFLDECV
KAGLDSAIVHASKILPIARFDEEQVTTALDLIYDRRSEGYDPLQKLMALFEGATTKSLKA
GKAEELAALPLDERLKRRIIDGEKNGLEADLDAALQDRPALDIVNETLLDGMKVVGELFG
SGQMQLPFVLQSAEVMKTAVAHLEPHMEKSDAEGKGTIVLATVRGDVHDIGKNLVDIILS
NNGYNVVNLGIKQPVSAILDAAEEHRADVIGMSGLLVKSTVIMKENLEELNQRGLSADYP
VILGGAALTRAYVEQDLHEIYQGEVRYARDAFEGLRLMDALIGVKRGVPGAALPELKQRR
VRAAAVEVEERPEEGAVRSDVATDNPVPAPPFRGTRVIKGIQLKEYASWLDEGALFKGQW
GLKQARTGDGPTYEELVESEGRPRLRGLLDKLQTENLLEAAVVYGYFPCVSKDDDLIILD
EQGNERTRFTFPRQRRGRRLCLADFFRPEESGERDVVGLQVVTVGSRIGTETAKLFEANS
YRDYLELHGLSVQLAEALAEYWHARVRSELGFAGEDPDRMEDMFALQYRGARFSLGYGAC
PNLEDRAKIAALLEPERIGVHLSEEFQLHPEQSTDAIVIHHPEAKYFNAR
NT seq 3573 nt NT seq  +upstreamnt  +downstreamnt
atgggaagcgcaaagccgacagccgtcgcactccagggagcatcttccatggcctcgttg
ccgaatccgtccccttcgtccgcctccgccgcgagccggagccgaaccgacgccctacgc
gaagccctcgccacccgtgtggtggtggccgacggcgcgatgggcacgatgctccaggca
caggacccgacgctcgaggacttcgagaatctcgagggctgcaacgagatcctgaacctg
acccgccccgacatcgtgcgctccgtccacgaggcctacttcgcggtgggcgtcgactgt
gtggagaccaacaccttcggagccaaccactcggcgctcgccgagtacgacatcgccgac
cgtgtcttcgagctgtccgaggccggggcccggctggcccgcgaggtggccgacgagttc
ggcaccggcgacggccgccagcgctgggtcctcggctcgatcggccccggtacgaagctg
ccgacgctcggccatgtgggatacggcaccctgcgcgacggcttccaggcgaacgccgag
ggcctgatcgcgggcggcgcggacgccctgatcgtggagaccacgcaggacctgctccag
acgaagacctccgtgctgggcgcccggcgggcgatggacgcgaccggcgtggacctgccc
ctgctggtctcgatggcgttcgagacgaccggcaccatgctgctgggctccgagatcggc
gccgcgctcacggcgctcgagccgctcggcatcgacatgatcggcctgaactgctcgacc
ggccccgcggagatgagcgagcacctgcgctatctcacccgccactcccgcatcccgctg
ctctgcatgccgaacgccggtctgccggtgctgaccaaggacggcgcgcacttcccgctc
ggccccgagggactggccgacgcccaggagaacttcgtacgcgactacggcctgtccctg
gtcggcggctgctgcggtacgacacccgaacacctgcgccagctcgtggagcgggtgcgg
ggggtcgagcccaccgagcggcgcccccagcccgagccgggcgccgcctccctctaccag
accgtcccgttccgccaggacaccgcgtacatggcgatcggtgagcgcaccaacgccaac
ggctccaagaagttccgcgaggccatgctggacgcccgctgggacgactgcgtggagatg
gcccgcgaccagatccgcgagggcgcgcacatgctcgacctgtgcgtcgactacgtgggc
cgcgacggcgtcgccgacatggaggaactggccggccgcttcgccaccgcctccacgctg
ccgatcgtgctggactccaccgaggtcgacgtcctgcgcgccggactggagaagctcggc
ggccgggccgtcatcaactccgtcaactacgaggacggggacggccccgagtcgcggttc
gcgaaggtcacccggctcgcccaggaacacggcgccgcgctgatcgcgctgaccatcgac
gaggagggccaggcccgcaccgtcgagaccaaggtcgccatcgccgagcggctcatcgag
gacctgacgacgaactggggcatccacgagtcggacatcctcatggactgtctgaccttc
accatctgcaccggtcaggaggagtcccggggggacggcatcgccacgatcgaggcgatc
cgcgagctgaagcgccgccgcccggacgtccagaccacgctgggcctgtcgaacatctcc
ttcggcctcaacccggcggcccgcatcctgctcaactcggtcttcctcgacgagtgcgtg
aaggcgggcctggactcggcgatcgtgcacgcgagcaagatcctgccgatcgcgcgcttc
gacgaggagcaggtcaccaccgcgctcgacctgatctacgaccggcgctccgaggggtac
gacccgctccagaagctgatggcgctgttcgagggagccaccaccaagtccctcaaggcg
ggcaaggccgaggaactggccgccctgcccctggacgagcggctcaagcggcgcatcatc
gacggtgagaagaacggcctggaggccgacctcgacgcggcactccaggaccggccggcc
ctcgacatcgtcaacgagacactcctcgacggcatgaaggtcgtcggcgaactgttcggg
tccggccagatgcagctgccgttcgtcctccagtccgccgaggtcatgaagacggcggtg
gcccacctggaaccgcacatggagaagtcggacgccgagggcaagggcaccatcgtcctc
gccaccgtccgcggcgacgtgcacgacatcggcaagaacctcgtcgacatcatcctgtcc
aacaacggctacaacgtcgtcaacctcggcatcaagcagccggtctccgcgatcctggac
gccgccgaggagcaccgggccgacgtcatcggcatgtccgggctgctggtcaagtccacg
gtgatcatgaaggagaacctggaggagctgaaccagcgcgggctgtcggccgactacccg
gtcatcctcggcggcgcggcgctgacccgcgcgtatgtcgagcaggacctgcacgagatc
taccagggcgaagtccgctacgcccgggacgcgttcgagggcctgcgcctgatggacgcg
ctgatcggcgtgaagcggggcgtgcccggtgcggcgctgcccgagctgaagcagcgccgg
gtgcgcgcggccgcggtcgaggtcgaggagcggccggaggagggcgcggtccgctccgac
gtcgccaccgacaaccccgtccccgcgccgccgttccggggcacccgcgtcatcaagggc
atccagctcaaggagtacgcctcctggctggacgagggcgccctgttcaagggccagtgg
ggcctcaagcaggcgcgcacgggcgacgggccgacctacgaggaactggtggagagcgag
ggccggccccggctgcgcggactgctcgacaagctccagaccgagaacctgctcgaagcg
gccgtcgtctacggctacttcccgtgtgtgtccaaggacgacgacctgatcatcctggac
gagcagggcaacgagcgcacccgcttcacgttcccgcgccagcgccgcggccgcaggctg
tgcctggccgacttcttccgcccggaggagtccggcgagagggatgtcgtcgggctccag
gtcgtcaccgtcggctcgcggatcggcacggagaccgccaagctcttcgaggcgaactcc
taccgcgactacctcgaactgcacggcctgtccgtgcagttggcggaggcgctggccgag
tactggcacgcccgggtccgttccgagctgggcttcgccggcgaggacccggaccggatg
gaggacatgttcgccctccagtaccggggcgcccgcttctccctcggctacggcgcctgc
cccaacctggaggaccgcgccaagatcgccgctctgctcgagccggagcgcatcggcgta
cacctgtccgaggagttccagctgcacccggagcagtccacggacgcgatcgtgatccac
cacccggaggcgaagtacttcaacgcgcgatga

DBGET integrated database retrieval system