KEGG   Streptomyces avermitilis: SAVERM_6682Help
Entry
SAVERM_6682       CDS       T00126                                 

Gene name
prcA
Definition
(GenBank) putative 20S proteasome alpha-subunit
  KO
K03432  proteasome alpha subunit [EC:3.4.25.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma03050  Proteasome
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    SAVERM_6682 (prcA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sma01002]
    SAVERM_6682 (prcA)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:sma03051]
    SAVERM_6682 (prcA)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     SAVERM_6682 (prcA)
Peptidases and inhibitors [BR:sma01002]
 Threonine peptidases
  Family T1: proteasome family
   SAVERM_6682 (prcA)
Proteasome [BR:sma03051]
 Prokaryotic proteasome
  Core particles (20S proteasome)
   SAVERM_6682 (prcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Proteasome ATP-synt_ab SH3_14
Motif
Other DBs
NCBI-ProteinID: BAC74393
NITE: SAV6682
UniProt: Q828I7
Position
7993807..7994568
Genome map
AA seq 253 aa AA seqDB search
MSTPFYVSPQQAMADRAEYARKGIARGRSLVVLQFADGIVFVGENPSRALHKFSEIYDRI
GFAAAGKYNEYENLRIGGVRYADLRGYTYDRDDVTARGLANVYAQTLGTIFSSAAEKPYE
VELVVAEVGETPEGDQIYRLPHDGSIVDEHGSVAVGGNAEQISTYLDQRHQDGMTLAEAL
KLAVQSLSRDTNGSEREIPAERLEVAVLDRTRPQQRKFKRIVGRELSRLLEAAGASTAGE
AGSAEDEGSDDEK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgacgccgttctatgtctccccccagcaggccatggccgaccgggcggagtacgcc
cgcaagggcatcgcccgtggtcgcagccttgtcgtgctgcagttcgccgacggcatcgtg
ttcgtcggcgagaacccgtcccgcgcgctgcacaagttcagcgagatctacgaccggatc
ggcttcgcggccgccggcaagtacaacgagtacgagaacctccggatcggcggcgtccgc
tacgccgatctgcgcggttacacctacgaccgggacgacgtgaccgctcgcggtctcgcc
aacgtctacgcccagacgctgggcacgatcttctccagcgcggccgagaagccgtacgag
gtggagctggtggtcgccgaggtgggggagaccccggagggtgaccagatctaccggctg
ccgcacgacggctcgatcgtggacgagcacggctcggtcgcggtcggcggcaacgccgag
cagatcagcacctacctggatcagcgccaccaggacggtatgacgctcgccgaggcgctc
aagctggccgtccagtccctgtcccgcgacacgaacggcagcgagcgggagatccccgcc
gagcgcctggaggtcgcggtcctggaccgtacgcgcccgcagcagcgcaagttcaagcgg
atcgtgggccgtgagctctctcgtctgctggaggcggccggagcgagcaccgcgggcgag
gccgggagtgccgaggacgagggctccgacgacgagaagtag

DBGET integrated database retrieval system