KEGG   Streptomyces avermitilis: SAVERM_6693Help
Entry
SAVERM_6693       CDS       T00126                                 

Gene name
tatC
Definition
(GenBank) putative sec-independent protein translocase protein TatC
  KO
K03118  sec-independent protein translocase protein TatC
Organism
sma  Streptomyces avermitilis
Pathway
sma03060  Protein export
sma03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SAVERM_6693 (tatC)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SAVERM_6693 (tatC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sma02044]
    SAVERM_6693 (tatC)
Secretion system [BR:sma02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein
   SAVERM_6693 (tatC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TatC CcmH
Motif
Other DBs
NCBI-ProteinID: BAC74404
NITE: SAV6693
UniProt: Q828H6
Position
8003476..8004423
Genome map
AA seq 315 aa AA seqDB search
MLKPARNKEKDPEGRMPLAEHLRELRNRLAKAMLAIVVVTAVAAFYYNDIINFFTKPVLE
SVGCPKTFAEVAKMPEGKQCAQITINGLLAPFTLALKVSLMAGVALASPVWLYQLWAFVA
PGLHRSEKKYAYAFVGTGVPLFMGGAFFAYKVLPTTAKVLMEFTPNGVSNLLPLDDLLDL
VTRMVVVFGLSFELPLLLVMLNLTGILTGKRMLGWWRGMIMGITVFAALATPSTDPLTML
ALAGPIWILYFGAVAFSLVNDRRKRRREAEGPDDDEASELDLTPEDIGEIETVSANRALP
EQSVTDRVNGYDDVT
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
ttgctcaagcctgcccgcaacaaggagaaggatcccgaggggcggatgcccctcgcggag
caccttcgtgagctcagaaaccggctcgcgaaggcgatgctggccatcgtcgtggtcacg
gccgtcgcagccttctactacaacgacatcatcaacttcttcaccaagccggtcctggaa
tccgtcgggtgcccgaagaccttcgccgaggtggcgaagatgcccgagggcaagcagtgc
gcgcagatcacgatcaacggtctgctcgcccccttcaccctggcgctgaaggtctccttg
atggcgggcgtcgcgctcgcctcgccggtctggctctaccagctctgggcgttcgtcgcg
ccgggcctgcacaggagcgagaagaagtacgcgtacgcgttcgtcgggacgggtgttccg
ctcttcatgggtggcgccttcttcgcctacaaggtgctgccgaccaccgccaaggtactg
atggagttcacgccgaacggcgtcagcaatctgctgccgctggacgatctcctcgacctc
gtcacgcgcatggtggtcgtcttcggcctctccttcgagcttccgctgctgctggtcatg
ctcaacctcactgggatcctcaccggcaagcgcatgctcggctggtggcgcggcatgatc
atgggcatcacggtcttcgcggccctcgccacgcccagcaccgacccgctgaccatgctg
gcgctcgccggccccatctggatcctgtacttcggagcggtcgccttctcgctcgtcaac
gaccggcgcaagcgccggcgtgaggccgaggggccggacgacgacgaggcctccgagctg
gacctcacccccgaggacatcggtgagatcgagaccgtgtcggcgaaccgggcgttgccg
gagcagtcggtcacggaccgggtcaacggttatgacgacgtgacctga

DBGET integrated database retrieval system