KEGG   Streptomyces avermitilis: SAVERM_6694
Entry
SAVERM_6694       CDS       T00126                                 

Gene name
dgkA
Definition
(GenBank) putative diacylglycerol kinase
  KO
K07029  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
sma  Streptomyces avermitilis
Pathway
sma00561  Glycerolipid metabolism
sma00564  Glycerophospholipid metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SAVERM_6694 (dgkA)
   00564 Glycerophospholipid metabolism
    SAVERM_6694 (dgkA)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     SAVERM_6694 (dgkA)
SSDB
Motif
Pfam: DAGK_cat
Other DBs
NCBI-ProteinID: BAC74405
NITE: SAV6694
UniProt: Q828H5
Position
8004455..8005345
AA seq 296 aa
MTSEITLFVNPTAGRGRGAHAAQPAASALRAAGFSVRTILGENAEDALARAREAVAGGTG
ALVAVGGDGMAHLALQAVGGTRTPLGLVAVGTGNDFARALGLPVRDPAAAGRVIAEALKG
ARLRDVDLGRVDGTWFGTVLASGFDSRVNDRGNRMRWPTGRFKYDLAMLAELAAFTPVPY
RMTLDDGAVREIEATLVAVGNGSSYGGGMKICADADLDDGLFDITVVGDCSRTTLLKVFP
KVYKGTHLDHPKVTVHRAAKVELVAQGITGYADGEPLGPLPLTAECIPGAARVAVP
NT seq 891 nt   +upstreamnt  +downstreamnt
gtgaccagcgagatcaccctcttcgtcaaccccaccgcgggacgcggccggggcgcccac
gcggcgcagccggccgcttcggctttgcgggcggcgggattctccgtccgtacgatcctc
ggggagaacgccgaggacgctctggcccgcgcgcgcgaagccgtcgcgggtggaacgggc
gccttggtggccgtcggcggggacggcatggcgcatctggcccttcaggccgtcggcggc
acgcgcaccccgctcggcctggtcgccgtcggcaccgggaacgacttcgcgcgggccctg
gggctcccggtgcgcgacccggcggccgcggggcgggtgatcgcggaggctctgaagggg
gcgcggctgcgtgacgtcgatctggggcgtgtcgacggaacctggttcggcaccgtcctc
gcctccggcttcgactcccgggtcaacgaccgcggcaaccgtatgcgctggcccaccggc
cgcttcaagtacgacctggcgatgctcgccgaactggccgccttcacgcccgtcccgtac
cggatgacgctcgacgacggagcggtccgggagatcgaggcgaccctcgtggcagtcggc
aacgggtcgtcgtacggcggcggcatgaagatctgcgcggacgccgacctcgacgacggg
ctgttcgacatcacggtcgtcggggactgcagccgtacgacgctgctcaaggtgttcccc
aaggtgtacaagggcacccacctcgaccatcccaaggtcaccgtgcaccgggccgcgaag
gtcgaactcgtcgctcagggcatcacggggtacgcggacggtgagccgctgggcccgctg
ccgctcacggcggagtgcatacccggggcggcgcgggtcgctgtgccctga

DBGET integrated database retrieval system