KEGG   Streptomyces avermitilis: SAVERM_6697Help
Entry
SAVERM_6697       CDS       T00126                                 

Definition
(GenBank) putative amidase family protein
  KO
K01457  allophanate hydrolase [EC:3.5.1.54]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma00791  Atrazine degradation
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SAVERM_6697
  09111 Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    SAVERM_6697
Enzymes [BR:sma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.54  allophanate hydrolase
     SAVERM_6697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase OB_aCoA_assoc
Motif
Other DBs
NCBI-ProteinID: BAC74408
NITE: SAV6697
UniProt: Q828H2
Position
complement(8009625..8011277)
Genome map
AA seq 550 aa AA seqDB search
MSTLSRVRAAYARVAAVDRPEIWIDLRSRADVEAEAAVTDERVAAGQRLPLAGRLFAVKG
NIDVHGLATTAGCPAYAYLPEADAPAVARLRAAGAIVLGTTNLDQFATGLVGTRSPYGAV
RGAYDPARISGGSSAGSAVAVALGIVDFALGTDTAGSGRVPAAFNGIVGLKPTRGLVPTT
GTVPACASLDCVTVFARTLPEAEQALAHLASPPGRDLPPLPQRAPGPWRVAVPPLPQLGE
LDEGWGEAYEAAVEHLVAAGVSVRTIDLSPFTEAAAMLYEGAFVAERYTAVGSFVDKLIS
EGGAGLDPTVAGIITRARDIPAHRLFADQERLATLRTRALAELGDADALLLPTTPGHPTL
AEVAADPLGANARLGRFTNSTNLFDLAAVAAPAGLTPAQLPFGVMLIGPAFTDGRLARIA
ALLQPQLSVAVIGAHLSGQPLNPQLLALGARRERTTTTAPAYRLHALPTTPPKPGLVHVR
QGGAAIETEVWRLPAEGLGRLLASLPRPMTLGQVELADGSRVPGFLCEPDALTDAADITE
YGGWRAYLDR
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgtccactctgtcccgtgtccgtgccgcgtacgcccgtgtggcggccgtcgaccgtccg
gagatctggatcgatctccgatcccgggcggacgtcgaggccgaggcggcggtgaccgac
gagcgcgtcgcggcgggtcagcggctcccgctcgccggacgcctgttcgccgtcaagggc
aacatcgacgtccacggcctggcgaccaccgcgggctgccccgcgtacgcctacctgccc
gaggccgacgccccggccgtcgcccggctccgggcggccggcgcgatcgtgctcggcacg
acgaacctggaccagttcgccaccggcctggtcggcacccgttccccgtacggggcggtg
cgcggcgcgtacgacccggcgaggatcagcggcggctccagcgcgggctcggccgtggcc
gtggccctgggcatcgtggacttcgccctcggtacggacaccgcgggctccggccgtgtc
cccgccgccttcaacggcatcgtcggcctcaagcccacccgcggcctcgtccccacgacg
ggcaccgtccccgcctgcgcctccctcgactgcgtcaccgtcttcgcccgtacgctcccg
gaggccgagcaggccctcgcgcacctggcgtcgccgcccggccgggacctccctccgctc
ccccagcgcgcccccggcccgtggcgcgtcgcggtcccgccgctgccgcagctcggcgag
ctggacgagggctggggcgaggcgtacgaggccgcggtggagcacctcgtggcggcgggc
gtctcggtccgcacgatcgatctcagcccgttcaccgaggccgcggcgatgctctacgag
ggtgcgttcgtggccgagcgctacaccgcggtggggagctttgtcgacaagttgatcagc
gagggcggtgcggggctcgaccccaccgtcgccggcatcatcacccgcgcccgggacatc
ccggcccaccggctcttcgccgaccaggaacgtctggccaccctgcgcacccgggcgctc
gccgaactcggtgatgccgacgccctgctgctgcccaccacccccggtcaccccacactc
gccgaggtcgccgccgacccgctgggcgccaacgcccgcctcgggcgcttcaccaactcc
acgaacctcttcgacctggccgcggtcgccgcccccgccggtctcacgcccgcccaactg
cccttcggggtgatgctgatcggcccggcgttcaccgacgggcggctcgcccggatcgcc
gccctgcttcagccacagctgagcgtggcggtgatcggcgcgcatctgtcgggccagccg
ctcaacccgcagctcctggccctgggcgcgcgacgggagcgtacgaccaccaccgcaccc
gcctaccggctgcacgccctgccgaccaccccgcccaagccgggcctcgtgcacgtgcgt
cagggcggcgccgcgatcgagacggaggtctggcggctgcccgccgaaggcctcggccgg
ctgctcgcctcactcccccgcccgatgacgctcggccaggtcgaactggccgacggcagc
cgcgtcccgggcttcctgtgcgagccggacgcgctcacggacgcggcggacatcacggag
tacgggggctggcgggcgtacctggaccgttga

DBGET integrated database retrieval system