KEGG   Streptomyces avermitilis: SAVERM_6698
Entry
SAVERM_6698       CDS       T00126                                 

Gene name
uahA
Definition
(GenBank) putative urea amidolyase
  KO
K01941  urea carboxylase [EC:6.3.4.6]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma00791  Atrazine degradation
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SAVERM_6698 (uahA)
  09111 Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    SAVERM_6698 (uahA)
Enzymes [BR:sma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.6  urea carboxylase
     SAVERM_6698 (uahA)
SSDB
Motif
Pfam: CT_A_B CPSase_L_D2 CT_C_D Biotin_carb_N Biotin_carb_C Biotin_lipoyl Dala_Dala_lig_C Biotin_lipoyl_2 HlyD_3 ATP-grasp HlyD_D23 ATP-grasp_5 ATP-grasp_3 LAL_C2 GCV_H NQRA
Other DBs
NCBI-ProteinID: BAC74409
NITE: SAV6698
UniProt: Q828H1
Position
complement(8011294..8014809)
AA seq 1171 aa
MTFDTLLVANRGEIAVRVIRTARELGLRTVAVYSDPDRSAPHVRLADEAVRLGPAPAKES
YLDADLVLKAAKDTGAGAIHPGYGFLSEDAAFARRCEDAGIVFVGPTPEQLELFGAKHTA
RAAAEAAGVPLAPGTGLLASLDEALDAASRIGYPVMLKATGGGGGIGMSACRSAAELAES
WERVRRVTAASFSSAGIFLERLVEHARHVEVQVFGDGRGRVVTLGDRDCSLQRRNQKVVE
EAPAPGLPSHVRDHLASAARDLCAAVGYRSAGTVEFVYDAAREEAYFLEVNTRLQVEHPV
TEEIYGVDLVAWMLRLAGGDADVVRDPGPPRGHAVEARVYAEDPSREHRPSAGLLTRVEF
PQGVRVDGWVETGTEVTTSYDPMLAKVVAYGSDRAHALARLDEALARTRVDGIETNLGLV
RAALADHGLRTATHTTATLAKITDPTPRVEVVAAGTLTTVQDWPGRTGYWQVGVPPCGPM
DDRSFRLGNRALGNEEGAPGLECTLRGPALRFTHATTVCVTGAPAPVTVDGTPVAQWEPV
TVPAGALLEVGAPAEPGLRTYVLFAGGLDVPAFLGSAATFTLGRFGGHGGRALRTGDVLH
GGSVTDRGAPVPAGDRPVFATEWHVGALEGPHAAPEFFTEDDIRDFYAAGWKVHFNSART
GVRLVGPKPRWARSDGGEAGLHPSNIHDTPYSVGAVDYTGDMPVLLGPDGPSLGGFVCPA
TVATAERWKLGQLRPGDTVRFTPLAEDGSTRPAIVDGGVLARDGDVTYRRSGDDNLLVEF
GPMQLDLALRMRVHALMEAVAEAGLDGVTDLTPGIRSLQIRTDPRRLPLRELLAVVRETV
SALPPTDQLVVPSRTVHLPLSWDDPATREAIERYMAGVRDDAPWCPWNIEFIRRVNGLES
VADVYDTVFDAEYLVLGLGDVYLGAPVATPLDPRHRLVTTKYNPARTWTAENSVGIGGAY
LCVYGMEGPGGYQFVGRTTQVWSGWQQRGAFEPGSPWLLRFFDRIKWYAVGPDELLDLRA
DIASGRFVPRVEEGEFSLAGYESFLAANAGSIAAFRARQGAAFAAERDAWEAAGEFARAE
AATAPEAPPAEVTVPVGGALVEAEFAASVWQLNVGPGDAVTAGQPLLTLEAMKMESRVPA
PMAGVVTEILARPGDQVAAGTALVVLAPATS
NT seq 3516 nt   +upstreamnt  +downstreamnt
atgaccttcgacaccctgctcgtcgccaaccggggcgagatagccgtccgcgtcatccgc
acggcgcgtgaactcggcctgcgcaccgtcgcggtgtactccgacccggaccgctcggcg
ccccatgtccggctcgccgacgaggccgtacgcctgggccccgcgcccgcgaaggagtcg
tacctcgacgcggatctcgtactgaaggccgccaaggacaccggcgccggcgcgatccac
cccggctacggcttcctctccgaggacgcggcgttcgcgcgccgctgcgaggacgccggg
atcgtgttcgtcggaccgacgcccgagcagctggaactcttcggcgcgaagcacacggcg
cgggccgcggccgaggcggccggggtgccgctcgcacccggcacggggctgctcgcctcg
ctcgacgaagcgctcgacgcggcctcccgcatcggctatcccgtcatgctcaaggccacc
ggcggcgggggcggcatcggcatgtcggcctgccgttccgccgccgaactggccgagtcg
tgggagcgggtgcggcgcgtcaccgcggcctcgttctcctcggcggggatcttcctggaa
cgcctggtcgagcacgcccgccatgtcgaggtacaggtcttcggcgacggccggggccgg
gtcgtcaccctcggcgaccgggactgctcgctccaacgccgcaaccagaaggtggtcgag
gaggcccccgcgccgggactcccctcacacgtgcgcgaccacctcgcctcggcggcacgg
gacttgtgcgccgcggtcggctaccgctccgccggaaccgtcgagttcgtgtacgacgcc
gcccgcgaggaggcgtacttcctcgaggtcaacacccgtctccaggtggagcatccggtc
accgaggagatctacggggtcgacctggtcgcctggatgctgcggctcgcgggcggcgac
gccgacgtcgtacgcgatccggggccgccccgcggccacgccgtggaggcccgggtgtac
gcggaggacccctcccgcgagcaccggcccagcgcgggcctgctgacgcgggtggagttc
ccgcagggcgtacgggtggacggctgggtggagacggggacggaggtcacgacgtcgtac
gaccccatgctcgccaaggtcgtggcgtacgggtccgaccgggcgcacgcgctggcccgc
ctcgacgaggcgctggcccggacgcgggtcgacggcatcgagacgaatctggggctcgtc
cgggcggcgctcgccgaccacggcttgcgcaccgccacccacacgacggcgacactggcc
aagatcaccgaccccactccgcgcgtcgaggtggtcgcggccggcacgctcaccaccgtc
caggactggccgggccgcaccggctactggcaggtgggcgtgccgccgtgcggcccgatg
gacgaccgctccttccggctcggcaaccgggcgctcgggaacgaggagggagcgccgggt
ctggagtgcaccctgcggggaccggcgctgcgcttcacccacgccacgacggtgtgcgtc
acgggcgccccggcaccggtcaccgtggacggaacgccggtcgcccagtgggagccggtg
acggtgcccgccggggccctcctggaggtcggcgcccccgccgagcccggcctgcggacc
tatgtgctgttcgcgggcggcctggacgtccccgcgttcctcggcagcgcggccaccttc
acactgggccggttcggcgggcacggcgggcgggcgctgcgcacgggggacgtgctgcac
ggcgggtcggtcacggaccggggcgctcccgtgcccgccggggaccggccggtgttcgct
acggagtggcacgtcggcgccctggaaggaccgcacgccgcaccggagttcttcaccgag
gacgacatccgcgacttctacgcggccggctggaaggtccacttcaactcggcccggacg
ggcgtacgactggtcggacccaagccccgctgggcgcgctcggacggcggagaggcgggg
ctgcacccgtccaacatccacgacaccccgtactcggtcggtgccgtcgactacacgggc
gacatgccggtactgctcggcccggacgggccctcgctcggcggtttcgtctgcccggcg
acggtcgccacggcggagcgctggaagctcgggcagctgcgccccggcgacacggtccgc
ttcacaccgctggccgaggacggctcgacgcggcccgcgatcgtggacggcggggtgctc
gcacgggacggcgacgtgacctaccggcgcagcggcgacgacaacctgctggtcgaattc
ggcccgatgcagctcgacctggccctgcgcatgcgggtgcacgcgctgatggaagcggtg
gccgaagccgggctggacggcgtcacggacctcaccccgggcattcgctcgctccagatc
cggacggacccgcgccgcctgccgctacgcgaactcctcgcggtcgtacgggagacggtg
agcgcgctcccgcccaccgaccagctcgtcgtcccgtcccgcacggtccacctccccctc
tcctgggacgacccggccacccgcgaggcgatcgagcgctacatggcgggcgtgcgcgac
gacgcgccctggtgcccgtggaacatcgagttcatccgccgcgtcaacggcctggagtcg
gtggcggacgtgtacgacacggtcttcgacgcggagtacctcgtactcggcctgggcgac
gtgtacttgggagcgccggtggccacaccgctcgacccgcgccaccgcctggtcaccacc
aagtacaacccggcgcgcacctggaccgccgagaactcggtcggcatcggcggcgcgtac
ctgtgcgtctacgggatggagggccccggcggctaccagttcgtgggccgcacgacccag
gtctggtcgggctggcagcagcgcggcgcgttcgaaccgggctcgccgtggctgctgcgc
ttcttcgaccggatcaagtggtacgccgtcgggcccgacgaactcctcgacctgcgcgcc
gacatcgcctcgggccgcttcgtgccgcgcgtcgaggagggcgagttctcgctggccggg
tacgagtccttcctcgccgcgaacgccggctccatcgccgccttccgggcccgccagggc
gcggccttcgcggcggagcgggacgcgtgggaggcggcgggcgagttcgcgcgggccgag
gcggcgacggcgcccgaggccccgccggccgaggtgaccgttccggtgggcggcgctctg
gtggaggccgagttcgccgcgtcggtctggcagctgaacgtgggaccgggcgacgcggtg
acggccggccagccgctgctcaccctggaggcgatgaagatggagtccagggtgcccgcg
ccgatggccggtgtggtgacggagatcctggccaggccgggcgatcaggtggcggcgggc
acggcgctggtcgtgctcgcaccggccacgagctga

DBGET integrated database retrieval system