KEGG   Streptomyces avermitilis: SAVERM_6763
Entry
SAVERM_6763       CDS       T00126                                 

Gene name
argC
Definition
(GenBank) putative N-acetyl-gamma-glutamyl-phosphate reductase
  KO
K00145  N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01210  2-Oxocarboxylic acid metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SAVERM_6763 (argC)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.38  N-acetyl-gamma-glutamyl-phosphate reductase
     SAVERM_6763 (argC)
SSDB
Motif
Pfam: Semialdhyde_dh Semialdhyde_dhC NAD_binding_10 DapB_N
Other DBs
NCBI-ProteinID: BAC74474
NITE: SAV6763
UniProt: Q828A6
Position
8079875..8080903
AA seq 342 aa
MAVRVAVAGASGYAGGEALRLLLAHPEVEIGALTGNSNAGQKLGALQPHLLPLADRVLQE
TSPDVLAGHDVVFLALPHGQSAAVAEQLGPDVLVVDMGADFRLRNPADWEKFYGSPHAGT
WPYGLPELPGGRAALEGSKRIAVPGCYPTAVSLALFPAYAAALAEPEAVIVAASGTSGAG
KAAKPHLLGSEVMGSMSPYGVGGVHRHTPEMIQNLGAAAGEPVSVSFTPTLAPMPRGILA
TCTAKARAGVTAESVRAAYEKAFADEPFVHLLPEGQWPATASVYGSNAVQVQVAYDAAAQ
RIIAISAIDNLTKGTAGGALQSMNIALGLPEELGLSTIGVAP
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggcggtacgagtggcagtggccggagcaagtgggtacgcgggcggagaagcgctgcgg
ctgctcctcgcgcaccccgaggtcgagatcggcgccctgaccggaaactccaacgccggc
cagaagctcggcgcgctgcagccgcacctgctgccgctcgccgaccgggtgctccaggag
acctcccccgacgtgctcgccgggcacgacgtcgtcttcctcgcgctgccgcacggccag
tccgccgccgtcgccgaacagctcggcccggacgtcctcgtcgtggacatgggtgccgac
ttccggctcaggaaccccgccgactgggagaagttctacggctccccgcacgccgggacc
tggccctacgggctcccggagctgccgggcggccgcgccgcgctggaggggtccaagcgc
atcgcggtgcccggctgctacccgacggccgtctcgctcgcgctcttccccgcgtacgcg
gccgcactcgccgaaccggaggccgtgatcgtcgccgcctccggcacctccggcgcgggc
aaggcggccaagccgcacctgctgggcagcgaggtcatgggctccatgtccccgtacggc
gtcggcggcgtccaccgccacacccccgagatgatccagaacctcggcgcggccgccggc
gagcccgtctccgtctccttcacgccgaccctcgcgccgatgccccgcggcatcctcgcc
acctgcaccgcgaaggccagggccggcgtcaccgccgagtccgtacgggccgcgtacgag
aaggccttcgccgacgaaccgtttgtgcacctgctccccgaggggcagtggcccgccacg
gcgtccgtctacggttccaacgccgttcaggtccaggtcgcgtacgacgcggccgcacag
cggatcatcgcgatcagcgccatcgacaacctcaccaagggcaccgcgggcggcgccctc
cagagcatgaacatagccctcgggctccccgaggagctgggcctttccacgatcggagtc
gcaccgtga

DBGET integrated database retrieval system