KEGG   Streptomyces avermitilis: SAVERM_6765
Entry
SAVERM_6765       CDS       T00126                                 

Gene name
argB
Definition
(GenBank) putative N-acetylglutamate 5-phosphotransferase
  KO
K00930  acetylglutamate kinase [EC:2.7.2.8]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01210  2-Oxocarboxylic acid metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SAVERM_6765 (argB)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.8  acetylglutamate kinase
     SAVERM_6765 (argB)
SSDB
Motif
Pfam: AA_kinase
Other DBs
NCBI-ProteinID: BAC74476
NITE: SAV6765
UniProt: Q828A4
Position
8082048..8082962
AA seq 304 aa
MSHGPTRKHTALPKAQILIEALPWLTRHNGKTVVVKFGGNAMIDEELKAAFAQDIVFLHH
AGLKPVVVHGGGPQISAALDRHGIVSEFKAGLRVTTEDAMDVVRMVLAGQVQRELVGLLN
QHGPLAVGLTGEDAHTITATKHQPEIDGELVDIGRVGEITEIDTGAIEALLADGRIPVVS
SIARSQDDGHVYNVNADTAAAALAAALGAETLMVLTDVEGLYEDWPDSDEVISRLTASEL
EKLLPELASGMVPKMEGCLHAVRNGVTTARVIDGRVQHSILLEIFTDEGIGTMVVPDEEE
GDAV
NT seq 915 nt   +upstreamnt  +downstreamnt
atgagccacggacccacgcggaaacacaccgcccttcccaaagcccagatcctcatcgaa
gcgctgccctggctgacccggcacaacggcaagaccgtcgtcgtcaagttcggcggcaac
gcgatgatcgacgaggagctgaaggcggcgttcgcgcaggacatcgtgttcctgcaccac
gccggtctgaagcccgtcgtcgtgcacggcgggggcccgcagatcagcgcggccctggac
cggcacggcatcgtcagcgagttcaaggcgggcctcagggtgaccaccgaggacgccatg
gacgtcgtacgcatggtgctcgccgggcaggtgcagcgcgagctggtcgggctgctcaac
cagcacggaccgctcgccgtcggactcaccggcgaggacgcgcacaccatcaccgccacc
aagcaccagcccgagatcgacggggaactcgtcgacatcgggcgggtgggcgagatcacc
gagatcgacacgggcgcgatcgaggcactgctcgccgacggccggatcccggtcgtctcc
tcgatcgcccgctcccaggacgacggacatgtctacaacgtcaatgctgatacggcggct
gcggcactcgctgcggcattgggcgccgaaaccctcatggtcctcacggacgtcgagggc
ctctacgaggactggcccgacagcgacgaggtgatcagtcgcctcaccgcctccgaactg
gagaagctgctgcccgagctggccagcggcatggtgccgaagatggagggctgtctgcac
gccgtacgcaacggcgtcaccacggcccgcgtcatcgacggccgggtccagcactcgatc
ctgctggagatcttcaccgacgaaggcatcggcacgatggtcgtgccggacgaggaagag
ggggatgccgtatga

DBGET integrated database retrieval system