KEGG   Streptomyces avermitilis: SAVERM_6766
Entry
SAVERM_6766       CDS       T00126                                 

Gene name
argD
Definition
(GenBank) putative N-acetylornithine aminotransferase
  KO
K00821  acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma00300  Lysine biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01210  2-Oxocarboxylic acid metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
sma_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    SAVERM_6766 (argD)
   00220 Arginine biosynthesis
    SAVERM_6766 (argD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sma01007]
    SAVERM_6766 (argD)
Enzymes [BR:sma01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.11  acetylornithine transaminase
     SAVERM_6766 (argD)
    2.6.1.17  succinyldiaminopimelate transaminase
     SAVERM_6766 (argD)
Amino acid related enzymes [BR:sma01007]
 Aminotransferase (transaminase)
  Class III
   SAVERM_6766 (argD)
SSDB
Motif
Pfam: Aminotran_3 Beta_elim_lyase Aminotran_5
Other DBs
NCBI-ProteinID: BAC74477
NITE: SAV6766
UniProt: Q828A3
Position
8082959..8084170
AA seq 403 aa
MTGTATNAELTERWQGALMNNYGTPRLPLVRGAGTRLWDADGKEYLDFVGGIAVNALGHA
HPAIVEAVSTQIASLGHVSNLFVAEPPVALAERLLQLFGRDGRVYFCNSGAEANEAAFKI
GRLTGRSHMVATQGGFHGRTMGALALTGQPGKQEPFLPLPGDVTHVPYGDAQALAAAVTE
ETALVVIEPIQGENGVVVPPAGYLKAARAITAATGSLLVLDEVQTGIGRTGHWFEYQAHE
GVLPDVVTLAKGLGGGLPLGATVAFGRAAELLQPGHHGTTFGGNPIACAAGLAVLETIQA
EGLLENVKSASEKLRDGIESLGHPLIAHVRGSGLLLGIVLTEPLAPQAQQAAQDAGFLVN
APAPDVVRLMPPLNLGDDEVDAFLRALPGVLDAVTNGDGRAKE
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgaccggcaccgcgaccaacgccgagctgaccgagcggtggcagggcgccctcatgaac
aactacggcaccccgcgcctgcccctcgtccgcggcgcgggcaccaggctgtgggacgcc
gacggcaaggagtacctggacttcgtcggcggcatcgcggtcaacgccctcggccacgcc
caccccgcgatcgtcgaagcggtcagcacgcagatcgcctcgctcggccatgtctccaac
ctcttcgtcgccgagccgcccgtcgcgctcgccgaacggctgctccagctcttcgggcgc
gacggccgggtctacttctgcaactccggggccgaggccaacgaggccgccttcaagatc
gggcggctgaccgggcggtcccacatggtcgccacccagggcggcttccacggccgcacc
atgggcgcgctcgccctcacgggccagcccggcaagcaggagccgttcctgccgttgccc
ggcgacgtcacgcacgtcccgtacggcgacgcgcaggccctggccgccgcggtcaccgag
gagacggccctggtcgtcatcgaaccgatccagggcgagaacggggtcgtggtcccgccc
gccggctatctgaaggccgcccgggcgatcaccgccgccaccgggtccctcctcgtcctc
gacgaggtgcagaccggcatcggccgtaccgggcactggttcgagtaccaggcccacgag
ggcgtcctgcccgacgtcgtcacgctcgcgaagggactcggcggcgggctgccgctcggc
gcgaccgtcgccttcggacgcgccgccgagctgcttcagccgggccaccacggcaccacc
ttcggcggcaacccgatcgcctgcgcggccggactcgccgtcctcgagaccatccaggcc
gagggcctgctggagaacgtgaagtccgcgagcgagaagctgcgcgacggaatcgagtcg
ctgggccacccgttgatcgcccacgtccggggctcgggcctcctcctgggtatcgtgctc
accgagccgctcgcgccccaggcgcagcaggcggctcaggacgccggtttcctggtgaac
gcgcccgcccccgatgtcgtacggctgatgccgccgctgaacctcggcgacgacgaggtg
gacgctttcctccgggcgcttcccggcgtcctcgacgcggtcaccaacggggacggacga
gccaaagaatga

DBGET integrated database retrieval system