KEGG   Streptomyces avermitilis: SAVERM_6778
Entry
SAVERM_6778       CDS       T00126                                 

Gene name
argG2
Definition
(GenBank) putative argininosuccinate synthase
  KO
K01940  argininosuccinate synthase [EC:6.3.4.5]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma00250  Alanine, aspartate and glutamate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01230  Biosynthesis of amino acids
Module
sma_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAVERM_6778 (argG2)
   00220 Arginine biosynthesis
    SAVERM_6778 (argG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_6778 (argG2)
Enzymes [BR:sma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     SAVERM_6778 (argG2)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAVERM_6778 (argG2)
SSDB
Motif
Pfam: Arginosuc_synth QueC Asn_synthase
Other DBs
NCBI-ProteinID: BAC74489
NITE: SAV6778
UniProt: Q827Z1
Position
8094879..8096093
AA seq 404 aa
MQCEEKPVTERVVLAYSGGLDTSVAIGWIAEETGAEVIAVAVDVGQGGEDLDVIRKRALA
CGAVEAEVADAKDEFADEYCLPAVKANALYMDRYPLVSALSRPTIVKHLVAAAQKHGATT
VAHGCTGKGNDQVRFEAGIVALAPGLKCIAPVRDYAMTRDKAIAFCEEKRLPIATTKKSP
YSIDQNVFGRAVETGFLEDIWNAPIEDIYEYTSNPAEPREADEVVISFKEGVPVAIDGRP
VTVLQAIQQLNERAGAQGVGRIDMVEDRLVGIKSREVYEAPGAIALITAHQELENVTVER
ELARYKRQVEQRWGELVYDGQWFSPLKRALEGFIDEANQHVNGDIRMTLHGGRAVVTGRR
SETSLYDFNLATYDTGDSFDQAAAKGFIDIYSLSSKIAAKRDLA
NT seq 1215 nt   +upstreamnt  +downstreamnt
ttgcagtgtgaggagaagcccgtgaccgagcgcgtcgtactcgcctactcgggtggtctg
gacacctccgtcgccatcggctggatcgccgaggagacgggcgccgaggtcatcgccgtc
gcggtcgacgtcggccagggcggcgaggacctggacgtcatccgcaagcgcgcgctcgcc
tgcggtgccgtcgaggccgaggtcgcggacgccaaggacgagttcgccgacgagtactgc
ctcccggcggtcaaggccaacgccctctacatggaccgctacccgctggtctccgccctc
tcccggccgaccatcgtcaagcacctcgtcgccgccgcccagaagcacggcgccaccacg
gtcgcccacggctgcaccggcaagggcaacgaccaggtgcggttcgaggccggcatcgtc
gccctcgcccccggcctcaagtgcatcgccccggtccgtgactacgcgatgacccgggac
aaggcgatcgccttctgcgaggagaagcggctcccgatcgccaccaccaagaagtccccg
tactccatcgaccagaacgtcttcgggcgcgcggtcgagacgggcttcctggaggacatc
tggaacgcgccgatcgaggacatctacgagtacacctcgaacccggccgagccccgcgag
gccgacgaggtcgtcatctccttcaaggagggcgtcccggtcgccatcgacggccggccc
gtcaccgtgctccaggcgatccagcagctcaacgagcgcgccggcgcccagggcgtcggc
cggatcgacatggtcgaggaccggctcgtgggcatcaagtcccgcgaggtgtacgaggct
ccgggcgcgatcgctctcatcacggcccaccaggagctggagaacgtcaccgtcgagcgt
gaactcgcccgctacaagcggcaggtcgagcagcgctggggcgagctggtctacgacggc
cagtggttctccccgctcaagcgcgccctggagggcttcatcgacgaggccaaccagcac
gtcaacggcgacatccggatgaccctgcacggcggccgcgccgtcgtcaccggccggcgc
tccgagacgtcgctctacgacttcaacctcgccacgtacgacacgggcgacagcttcgac
caggccgcggccaagggcttcatcgacatctacagcctgtcgtcgaagatcgccgccaag
cgcgacctggcgtaa

KEGG   Streptomyces avermitilis: SAVERM_801
Entry
SAVERM_801        CDS       T00126                                 

Gene name
argG1
Definition
(GenBank) putative argininosuccinate synthase
  KO
K01940  argininosuccinate synthase [EC:6.3.4.5]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma00250  Alanine, aspartate and glutamate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01230  Biosynthesis of amino acids
Module
sma_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAVERM_801 (argG1)
   00220 Arginine biosynthesis
    SAVERM_801 (argG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_801 (argG1)
Enzymes [BR:sma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     SAVERM_801 (argG1)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAVERM_801 (argG1)
SSDB
Motif
Pfam: Arginosuc_synth QueC
Other DBs
NCBI-ProteinID: BAC68511
NITE: SAV0801
UniProt: Q82PS1
Position
952657..954111
AA seq 484 aa
MSKVLTSLPAGERVGIAFSGGLDTSVAVAWMRDKGAVPCTYTADIGQYDEPDIASVPGRA
KTYGAEIARLVDCRAALVEEGLAALTCGAFHIRSGGRAYFNTTPLGRAVTGTLLVRAMLE
DDVQIWGDGSTFKGNDIERFYRYGLLANPHLRIYKPWLDADFVTELGGRKEMSEWLLAHD
LPYRDSTEKAYSTDANIWGATHEAKTLEHLDTGVETVEPIMGVRFWDPAVEIATEDVTIG
FDQGRPVTINGKELASPVDLVMEANAIGGRHGMGMSDQIENRIIEAKSRGIYEAPGMALL
HAAYERLVNAIHNEDTLAQYHNEGRRLGRLMYEGRWLDPQALMVRESLQRWVGAAVTGEV
TLRLRRGEDYSILDTTGPAFSYHPDKLSMERTEDSAFGPVDRIGQLTMRNLDIADSRVKL
EQYAGLGLIGTGSPAIGAAQAAATGLIGTMPQMPEGSAEAIASRGEVSGDDEMLDRAAME
FGTD
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgtctaaggtcctcacctcccttcccgccggcgagcgcgtcggtatcgccttctcgggc
ggcctcgacacctcggtcgcggtcgcgtggatgcgcgacaagggcgccgtcccgtgcacc
tacaccgccgacatcggccagtacgacgagcccgacatcgcctcggtgccgggccgcgcg
aagacctacggtgccgagatcgcgcggctggtcgactgccgcgcggcgctggtcgaggag
ggcctggccgcgctcacctgcggggcgttccacatccgttcgggcgggcgtgcctacttc
aacaccacgccgctcggtcgcgccgtcacgggcaccctcttggtccgggcgatgctcgag
gacgacgtacagatctggggcgacggctcgaccttcaagggcaatgacatcgagcggttc
taccggtacggcctgctcgccaacccgcacctgcggatctacaagccgtggctggacgcg
gacttcgtgaccgagctcggcggccgcaaggaaatgtcggagtggcttctcgcccacgac
ctgccctaccgcgacagcacggagaaggcgtactccaccgacgccaacatctggggcgcc
acccacgaggccaagaccctggagcacctggacaccggcgtggagaccgtggagccgatc
atgggcgtgcggttctgggaccccgcggtcgagatcgccaccgaggacgtgacgatcggc
ttcgaccagggccgcccggtgacgatcaacggcaaggagctcgcctcccctgtcgacctg
gtcatggaggcgaacgcgatcggcggtcggcacggcatgggcatgtcggaccagatcgag
aaccggatcatcgaggccaagagccgcggcatctacgaggcgcccggcatggccctgctg
cacgcggcgtacgagcgcctggtcaacgcgatccacaacgaggacacgctcgcccagtac
cacaacgagggacggcgcctcggccggctgatgtacgagggccgctggctggacccgcag
gcgctgatggtgcgcgagtcgctgcagcgctgggtcggcgcggccgtcaccggcgaggtg
acgctgcgactgcggcgcggtgaggactactcgatcctcgacaccacgggcccggcgttc
agctaccacccggacaagctgtccatggagcgcaccgaggactcggcgttcggcccggtc
gaccggatcggccagctcaccatgcgcaacctggacatcgcggattcacgcgtcaagctg
gagcagtacgccggcctcggcctgatcggcaccggcagtcccgccatcggtgccgcccag
gcggccgcgaccggcctgatcggcaccatgccgcagatgccggagggcagcgccgaggcc
atcgcctcccgcggcgaggtctccggtgacgacgagatgctggaccgcgccgcgatggag
ttcggcacggactga

DBGET integrated database retrieval system