KEGG   Streptomyces avermitilis: SAVERM_6779
Entry
SAVERM_6779       CDS       T00126                                 

Gene name
argH
Definition
(GenBank) putative argininosuccinate lyase
  KO
K01755  argininosuccinate lyase [EC:4.3.2.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma00250  Alanine, aspartate and glutamate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01230  Biosynthesis of amino acids
Module
sma_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAVERM_6779 (argH)
   00220 Arginine biosynthesis
    SAVERM_6779 (argH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_6779 (argH)
Enzymes [BR:sma01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     SAVERM_6779 (argH)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAVERM_6779 (argH)
SSDB
Motif
Pfam: Lyase_1 ASL_C2
Other DBs
NCBI-ProteinID: BAC74490
NITE: SAV6779
UniProt: Q827Z0
Position
8096194..8097627
AA seq 477 aa
MSSNSGDVRLWGGRFADGPAEALAKLSASVHFDWRLAPYDIAGSRAHARVLHKANLLTDD
ELDRMLAGLDRLEADVADGTFVGTIADEDVHTALERGLLERLGPDLGGKLRAGRSRNDQV
ATLFRMYLRDHARVIGGLLADLQDALIGLAEAHPDVAMPGRTHLQHAQPVLFAHHVLAHV
QALSRDAERLRQWDERTAVSPYGSGALAGSSLGLDPESVAKDLGFEHGSVANSIDGTASR
DFVAEFAFITAMIGVNLSRIAEEVIIWNTKEFSFVTLHDAFSTGSSIMPQKKNPDIAELA
RGKSGRLIGNLTGLMATLKALPLAYNRDLQEDKEPVFDSCDQLEVLLPAFTGMMATLTVH
RERMEELAPAGFSLATDIAEWLVKQGVPFRVAHEVAGECVKVAEGEGIELDGLTDEQFAK
ISSHLTPEVRGVLNVPGALASRDGRGGTAPSAVAVQLAEVRTDVAAQHAWATAKQKN
NT seq 1434 nt   +upstreamnt  +downstreamnt
gtgagcagcaacagcggtgacgtacggctctggggcggccgtttcgccgacggtcccgcc
gaggccctggcgaagctgtccgcgtccgtccacttcgactggcggctcgcgccctacgac
atcgcaggttcgcgtgcccacgcgcgcgtgctgcacaaggcgaacctcctcacggacgac
gagctggaccgtatgctcgcgggcctcgaccggctcgaagccgatgtcgcggacggcacc
ttcgtgggcaccatcgccgacgaggacgtccacaccgccctggagcgcggcctgctggag
cgcctcggccccgacctcggcggcaagctccgcgccggccgctcccggaacgaccaggtc
gcgaccctcttccgcatgtacctgcgcgaccacgcccgcgtcatcggcggcctcctcgcc
gacctccaggacgcgctgatcggactggcggaggcccacccggacgtggcgatgcccggc
cgcacgcacctccagcacgcccagccggtgctcttcgcccaccacgtcctcgcgcacgtc
caggcgctgtcccgggacgccgagcggctgcgccagtgggacgagcgcacggccgtgtcg
ccgtacggctcgggtgccctcgccggttcctccctcggcctcgacccggagtcggtcgcg
aaggacctcggcttcgagcacggctcggtcgccaactccatcgacggcacggcctcccgt
gacttcgtcgccgagttcgccttcatcaccgcgatgattggggtgaacctctcccggatc
gccgaggaggtcatcatctggaacacgaaggagttctccttcgtcaccctccacgacgcc
ttctccaccggctcgtcgatcatgccgcagaagaagaacccggacatcgccgagctggcg
cgcggcaagtcgggccgcctgatcggcaatctgaccggcctgatggcgacgctcaaggcc
ctcccgctcgcgtacaaccgcgacctccaggaggacaaggagccggtcttcgactcctgc
gaccagctcgaagtcctgctccccgccttcaccggcatgatggcgacgctgaccgtccac
cgtgagcgcatggaggagctggccccggccgggttctcgctcgccaccgacatcgccgag
tggctggtcaagcagggcgtgccgttccgggtcgcgcacgaggtcgcgggcgagtgcgtg
aaggtcgccgagggcgagggcatcgagctggacggcctcaccgacgagcagttcgcgaag
atctcgtcccacctcacccccgaggtgcgcggcgtcctcaacgtcccgggcgccctggcc
tcccgcgacggccgcggcggtacggcacccagcgcggtcgccgtccagctcgccgaggtc
aggacggacgtggcggcacagcacgcctgggccaccgcgaagcagaagaactag

DBGET integrated database retrieval system