KEGG   Streptomyces avermitilis: SAVERM_6833Help
Entry
SAVERM_6833       CDS       T00126                                 

Gene name
ruvC
Definition
(GenBank) putative Holliday junction nuclease
  KO
K01159  crossover junction endodeoxyribonuclease RuvC [EC:3.1.22.4]
Organism
sma  Streptomyces avermitilis
Pathway
sma03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    SAVERM_6833 (ruvC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_6833 (ruvC)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.4  crossover junction endodeoxyribonuclease
     SAVERM_6833 (ruvC)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SAVERM_6833 (ruvC)
    RecFOR pathway proteins
     SAVERM_6833 (ruvC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvC
Motif
Other DBs
NCBI-ProteinID: BAC74544
NITE: SAV6833
UniProt: Q820F5
Position
8156649..8157179
Genome map
AA seq 176 aa AA seqDB search
MRVLGVDPGLTRCGVGVVEGVAGRPLTMRGVGVVRTPADAELGLRLVAIEQGIEQWLDEY
RPECVAVERVFSQHNVRTVMGTAQASAVAMLCAARRGIPVALHTPSEVKAAVTGSGRADK
AQVGAMVTRLLRLDAPPKPADAADALALAICHIWRAPAQNRLQQAVALHASKGRTA
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
gtgcgggtactgggcgttgaccccgggttgacccggtgcggtgtcggcgtggtcgaagga
gtcgccggccggcccctgaccatgcgcggtgtcggcgtcgtacggaccccggcggacgcc
gagttgggcctgcggctcgtggccatcgagcagggcatcgagcagtggctcgacgagtac
cggcccgaatgcgtcgccgtggagcgggtgttcagccagcacaacgtgcgtacggtgatg
ggcacggcccaggccagcgcggtcgccatgctctgcgcggcccgccgcggcatccccgtc
gccctgcacacccccagcgaggtcaaggccgccgtcaccggcagcggacgcgccgacaag
gcccaggtcggcgcgatggtgacccgcctgctgcggctcgacgcgccgcccaagcccgcc
gacgccgccgacgccctcgcgctcgccatctgccacatctggcgagcccccgcccagaac
agacttcagcaggccgtcgccctgcacgcatcgaaagggcgtaccgcatga

DBGET integrated database retrieval system