KEGG   Streptomyces avermitilis: SAVERM_6844Help
Entry
SAVERM_6844       CDS       T00126                                 

Gene name
hisS
Definition
(GenBank) putative histidyl-tRNA synthetase
  KO
K01892  histidyl-tRNA synthetase [EC:6.1.1.21]
Organism
sma  Streptomyces avermitilis
Pathway
sma00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SAVERM_6844 (hisS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sma01007]
    SAVERM_6844 (hisS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sma03016]
    SAVERM_6844 (hisS)
Enzymes [BR:sma01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.21  histidine---tRNA ligase
     SAVERM_6844 (hisS)
Amino acid related enzymes [BR:sma01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   SAVERM_6844 (hisS)
Transfer RNA biogenesis [BR:sma03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SAVERM_6844 (hisS)
 Prokaryotic Type
    SAVERM_6844 (hisS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_His tRNA-synt_2b HGTP_anticodon PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: BAC74555
NITE: SAV6844
UniProt: Q827T0
Position
8169763..8171025
Genome map
AA seq 420 aa AA seqDB search
MSTFKAPKGTYDLIPPDSAKYLAVREAIAAPLRNSGYGYIETPGFENVELFARGVGESTD
IVTKEMYAFETKGGDRLALRPEGTASVLRAALEANLHKAGNLPVKLWYSGSYYRYERPQK
GRYRHFSQVGAEAIGAEDPALDAELIILADQSYRSLGLRNFRILLNSLGDKECRPVYRAA
LQDFLRGLDLDEDTLRRAEINPLRVLDDKREDVQKQLGGAPLLRDYLCDACKAYHEEVRE
LITAAGVSFEDDAKLVRGLDYYTRTTFEFVHDGLGSQSAVGGGGRYDGLSEMIGGPALPS
VGWALGVDRTVLALEAEGVELELPSSTSVFAVPLGEEARRILFAKVTELRKVGIAADFAY
GGKGLKGAMKNANRSGARYTVVAGERDLAEGVVQLKDMESGEQTAVGVNEIVAELEARLG
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccttcaaggcccccaagggcacgtacgacctgattcctccggacagcgcgaag
tacctcgccgtgcgcgaggccatcgccgccccgctgcgcaactccggttacggctacatc
gagacgcccggcttcgagaacgtcgagctgttcgcgcgcggtgtcggtgagtccaccgac
atcgtgaccaaggagatgtacgccttcgagaccaagggcggcgacaggctggccctgcgc
cccgagggcaccgcctccgtgctgcgcgcggccctggaggccaacctgcacaaggcgggc
aacctgccggtcaagctctggtactcgggttcgtactaccgctacgagcgcccccagaag
ggccgctacaggcacttctcgcaggtcggcgccgaggcgatcggcgccgaggacccggcg
ctcgacgccgaactgatcatcctggcggaccagtcgtaccgctcgctgggtctgcgcaac
ttccggatcctcctcaactccctgggcgacaaggagtgccgcccggtctaccgggccgcg
ctgcaggacttcctgcgcggcctcgacctggacgaggacaccctccgccgcgccgagatc
aacccgctgcgggtcctcgacgacaagcgggaggacgtccagaagcagctcgggggcgct
ccgctgctgcgggactacctgtgcgacgcgtgcaaggcgtaccacgaggaggtgcgcgag
ctgatcactgcggcgggtgtctccttcgaggacgacgcgaagctggtgcgcggtctggac
tactacacgcgtacgaccttcgagttcgtccacgacggtctgggctcccagtccgcggtg
ggcggcggcggccgctacgacggactgtcggagatgatcggcggccccgcgctgccgtcc
gtcggctgggcgctgggcgtcgaccgcacggtcctcgccctggaggcggagggcgtcgag
ctcgaactcccctcgtccaccagcgtgttcgcggtgccgctcggggaggaggcccggcgg
atcctgttcgccaaggtcaccgagctgcggaaggtgggcatcgcggcggacttcgcgtac
ggcgggaagggcctgaagggcgcgatgaagaacgcgaaccggagcggggcgcggtacacg
gtcgtggcgggggagcgggatctcgccgagggtgtcgtgcagctcaaggacatggagtcc
ggcgagcagacggcggtcggggtgaacgagatcgtggcggagctcgaggcacggctcggc
tga

DBGET integrated database retrieval system