KEGG   Streptomyces avermitilis: SAVERM_6872Help
Entry
SAVERM_6872       CDS       T00126                                 

Gene name
rpoZ
Definition
(GenBank) RNA polymerase omega subunit
  KO
K03060  DNA-directed RNA polymerase subunit omega [EC:2.7.7.6]
Organism
sma  Streptomyces avermitilis
Pathway
sma03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    SAVERM_6872 (rpoZ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sma03021]
    SAVERM_6872 (rpoZ)
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_6872 (rpoZ)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     SAVERM_6872 (rpoZ)
Transcription machinery [BR:sma03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     SAVERM_6872 (rpoZ)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      SAVERM_6872 (rpoZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_pol_Rpb6
Motif
Other DBs
NCBI-ProteinID: BAC74583
NITE: SAV6872
UniProt: Q827Q2
Position
8200837..8201109
Genome map
AA seq 90 aa AA seqDB search
MSSSITAPEGIINPPIDELLEATDSKYSLVIYAAKRARQINAYYSQLGEGLLEYVGPLVD
THVHEKPLSIALREINAGLLTSEPVEGPAQ
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
gtgtcctcttccatcaccgcgcccgagggcatcatcaaccccccgatcgacgagctcctc
gaggccactgactcgaagtacagcctcgtgatctacgcggccaagcgggcccgtcagatc
aacgcgtactactcgcagctcggtgagggcctcctcgagtacgtcggtcccctcgtcgac
acccacgtccacgagaagccgctctcgatcgccctgcgcgagatcaacgccggtctgctg
acctccgagcccgtcgagggcccggcgcagtag

DBGET integrated database retrieval system