KEGG   Streptomyces avermitilis: SAVERM_6875Help
Entry
SAVERM_6875       CDS       T00126                                 

Gene name
priA
Definition
(GenBank) putative primosomal protein
  KO
K04066  primosomal protein N' (replication factor Y) (superfamily II helicase) [EC:3.6.4.-]
Organism
sma  Streptomyces avermitilis
Pathway
sma03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    SAVERM_6875 (priA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_6875 (priA)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     SAVERM_6875 (priA)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SAVERM_6875 (priA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PriA_3primeBD PIN_10
Motif
Other DBs
NCBI-ProteinID: BAC74586
NITE: SAV6875
UniProt: Q827P9
Position
8204328..8206490
Genome map
AA seq 720 aa AA seqDB search
MSSENGQGGGGGEEAPPEQLALIREAVRKAKVPKAKPRTWRGAALAKELPVARVLVDKGV
LHLDRYFDYAVPEELAAVAQPGVRVRVRFGAGGRTVRDGRREGGSLIDGFLVERVAESDY
GGPLAALAQVVSPEPVLGPELLGLARAVADRYAGSLADVLQLAVPPRHGRAEAGKTAEPL
PAPPAPEPGSWRRYARGAEFVKSLAAGGSPRAVWTALPGPDWAEEIARAVQATLASGRGA
LVVVPAGRPAARVDAALRALMGEGRHALLTADAGQERRYREWLAVRRGAVQAVVGTRAAM
FAPVRNLGLVVVWDDGDASHSDDNAPFPHVREVLELRATRDKCGFLLGSWSCTVEAAQLV
ESGWAAPLVAEREQVRAAAPLVRTVGDGDLARDEAARAARLPTLAWQAVREGLRHGPVLV
QVPRRGYVPRMACAQCRAPARCRHCAGPLEAHDAGALRCGWCGREDAAWHCPECGGFRLR
AQVVGARRTAEELGRAFPAVPVRTSGREQVLDTVSGAPALVVSTPGAEPVAEGGYAAALL
LDGWAMLGRPDLRAGEEALRRWIGAAALVRGQAAGGTVVVVAEPTLRPVQALVRWDPVGH
AVRELAERAELGFPPVSRMAAVSGTAEAVAGFLSGVELPSDAEVLGPVPLPVTEAGRPRR
VGGPPPGERWERALVRVPPGSGAALAGALKTAQAARMARGGGGNGSEAPVRIRIDPPDIG
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagcgagaacgggcaggggggcggcggtggcgaagaggcgccgccggagcagctt
gcgttgatccgtgaggccgtgcggaaggccaaggtgcccaaggccaagccgcggacgtgg
cggggagccgcgctggccaaggagttgcccgtcgcgcgtgtgctggtcgacaagggcgta
cttcatcttgatcggtacttcgactatgccgtgcccgaggaactggctgccgtcgctcag
ccgggagtgcgcgtccgtgtgcggttcggagccggcgggcgcaccgtgcgggacggcagg
cgggagggcggctcactgatcgacggcttcctcgtcgagcgggtcgccgagtccgactac
ggcgggccgctggccgcgctcgcgcaggtcgtgtcccccgagcccgtgctcggccctgag
ctgctcgggctcgcccgggccgtcgccgaccggtacgccgggagcctcgccgatgtgctc
cagctggccgttccgcccaggcacgggcgggccgaggccggcaagacggccgagccgctg
ccggctcctcccgcgcccgaacccggctcctggcggcggtacgcgcgcggggcggagttt
gtgaagtccctcgccgccgggggttcgccccgggccgtgtggaccgcgttgccggggccc
gactgggccgaggagatcgcccgggccgtgcaggccacgctcgcctcggggcgcggcgcg
ctcgtcgtcgtgccggccggacggcccgccgcgcgcgtcgacgcggcgctccgcgcgctg
atgggtgaggggcggcatgcactgctgaccgccgacgcggggcaggagcggcgctaccgg
gagtggctggccgtgcggcggggggccgtgcaggcggtggtcgggacgcgggccgcgatg
ttcgcgcccgtgcggaatctcgggctcgttgtcgtgtgggacgacggggatgcttcccac
agcgacgacaacgcgccgtttccccatgtgcgggaggtgctggagcttcgggcgacccgg
gacaagtgcgggtttctgctggggagctggagctgcacggtggaggccgcgcagcttgtc
gagagcgggtgggcggcaccgctcgtggccgagcgggaacaggtacgggcggctgctcct
ctcgtgcgcaccgtgggggacggggatctcgcgcgggacgaggcggcccgggccgcgcgg
ctgccgaccctcgcctggcaggccgtgcgggaggggctgcgccacggacccgtgctggtg
caggtgccccggcggggttacgtgccccggatggcctgcgcgcagtgccgggcgcccgcg
cggtgccggcactgcgcggggccgctggaggcgcacgacgccggggcgctgcggtgcggt
tggtgcggacgggaggacgcggcttggcactgtccggagtgcggtgggttccggttgcgg
gcgcaggtcgtgggggcgcggcggaccgccgaggagctgggtcgtgcgttcccggccgtg
ccggtgcgcacctccgggcgtgagcaggtgctcgacaccgtctcgggggcgcccgcgctc
gtggtgagtacgccgggggccgagccggtcgccgagggcgggtacgcggctgccctgctc
ctcgacgggtgggccatgctcggccggccggatctgcgggccggggaggaggcgctgcgg
aggtggatcggggcggccgcgctcgtccgggggcaggcggccggcgggaccgtggtcgtg
gtcgccgagccgacgttgcggcctgtgcaggcgctggtgcgctgggatcccgtcggacac
gcggtgcgcgaactcgccgagcgggccgagctggggtttccaccggtgtcgcggatggcc
gccgtgtcggggacggccgaggcggtcgcggggtttctgagcggggtcgaactaccctcg
gacgccgaggtgttggggccggtgccgttgccggtcacggaggccggacggcctcggcgc
gtgggcgggccgccgccgggggagcggtgggagcgagcgctcgtccgggtgccgccgggg
agcggggccgcgctggccggcgcgttgaagaccgcgcaggcggctcggatggcgcgtggg
ggcggggggaacgggagcgaggccccggtgcggattcggatcgatccgccggacatcggg
tga

DBGET integrated database retrieval system