KEGG   Streptomyces avermitilis: SAVERM_6975
Entry
SAVERM_6975       CDS       T00126                                 

Gene name
ptsA
Definition
(GenBank) putative phosphoenolpyruvate-dependent sugar phosphotransferase
  KO
K02777  sugar PTS system EIIA component [EC:2.7.1.-]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00500  Starch and sucrose metabolism
sma00520  Amino sugar and nucleotide sugar metabolism
sma01100  Metabolic pathways
sma02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_6975 (ptsA)
   00500 Starch and sucrose metabolism
    SAVERM_6975 (ptsA)
   00520 Amino sugar and nucleotide sugar metabolism
    SAVERM_6975 (ptsA)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    SAVERM_6975 (ptsA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sma02000]
    SAVERM_6975 (ptsA)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.-  
     SAVERM_6975 (ptsA)
Transporters [BR:sma02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Glucose-specific II component
    SAVERM_6975 (ptsA)
   N-Acetylglucosamine-specific II component
    SAVERM_6975 (ptsA)
   Maltose/glucose-specific II component
    SAVERM_6975 (ptsA)
   Beta-glucoside (arbutin/salicin/cellobiose)-specific II component
    SAVERM_6975 (ptsA)
   Trehalose-specific II component
    SAVERM_6975 (ptsA)
   N-Acetylmuramic acid-specific II component
    SAVERM_6975 (ptsA)
   Alpha-glucoside-specific II component
    SAVERM_6975 (ptsA)
SSDB
Motif
Pfam: PTS_EIIA_1 RnfC_N E1-E2_ATPase
Other DBs
NCBI-ProteinID: BAC74686
NITE: SAV6975
UniProt: Q827E9
Position
complement(8327473..8327922)
AA seq 149 aa
MTTVTSPLAGRAIGLAAVPDPVFSGAMVGPGTAIDPVREPSEAVAPVDGVIVSLHPHAFV
VVDGEGHGVLTHLGIDTVQLNGEGFELLVNKGDTVTRGQAVVRWNPAAVEEAGKSPVCPV
VALEATVDSLGDVRDEGDVKAGDPLFSWQ
NT seq 450 nt   +upstreamnt  +downstreamnt
atgaccaccgtgacgtcccctcttgcaggacgcgccatcggactcgccgcagtgccggac
cccgtcttctccggggcgatggtcggccccggcacggcgatcgaccccgtgcgcgagccc
tcggaggctgtcgcccctgtggacggagtcatcgtctcgcttcatccgcacgccttcgtg
gtcgtcgacggtgagggacacggggtgctgacgcacctcggcatcgacaccgtccagctc
aacggcgagggcttcgagctgctcgtcaacaagggtgacaccgtgacgcgcgggcaggcc
gtggtccgttggaacccggccgccgtcgaggaagccggcaagtccccggtgtgcccggtc
gtggcactcgaggccacggtcgattcgctgggcgatgtccgtgacgagggcgacgtgaag
gccggcgacccgctcttctcctggcagtga

DBGET integrated database retrieval system