KEGG   Streptomyces avermitilis: SAVERM_7076Help
Entry
SAVERM_7076       CDS       T00126                                 

Gene name
mug
Definition
(GenBank) putative G/U mismatch-specific DNA glycosylase
  KO
K03649  double-stranded uracil-DNA glycosylase [EC:3.2.2.28]
Organism
sma  Streptomyces avermitilis
Pathway
sma03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SAVERM_7076 (mug)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_7076 (mug)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.28  double-stranded uracil-DNA glycosylase
     SAVERM_7076 (mug)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SAVERM_7076 (mug)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: BAC74787
NITE: SAV7076
UniProt: Q826U9
Position
complement(8438343..8438783)
Genome map
AA seq 146 aa AA seqDB search
MTAATGHHFARPGNRFWPVLHLSGFTPRLLKPSEQGELLSYGLGITNVVARATARADELT
AQEYREGGRLLGAKVERLRPRWLAVVGVTAYRAAFDDRKARVGPQERTIGASRVWVLPNP
SGLNAHWTAATMAEEFGRLREAARDA
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgacggcggcgacgggccatcacttcgcccgccccggcaaccgcttctggcccgtgctg
cacctgtccggcttcaccccgcggctcttgaagccttcggaacagggcgagttgctctcg
tacggcctcgggatcacgaacgtggtggcgcgcgcgaccgcgcgtgccgacgagctgacc
gcgcaggagtaccgggagggcgggcggctgctcggtgccaaggtggagcggctgcgtcct
cggtggctcgcggtggtgggggtgaccgcgtaccgggcggccttcgacgaccggaaggcg
cgggtgggaccgcaggagcggacgatcggcgccagtcgggtgtgggtgctgcccaacccc
agcgggctgaacgcgcattggacggcggcgacgatggcggaggagttcggacggttgcgg
gaggccgcgcgggacgcgtga

DBGET integrated database retrieval system