KEGG   Streptomyces avermitilis: SAVERM_7105Help
Entry
SAVERM_7105       CDS       T00126                                 

Gene name
ureB
Definition
(GenBank) putative urease beta subunit
  KO
K01429  urease subunit beta [EC:3.5.1.5]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma00230  Purine metabolism
sma00791  Atrazine degradation
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SAVERM_7105 (ureB)
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SAVERM_7105 (ureB)
  09111 Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    SAVERM_7105 (ureB)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.5  urease
     SAVERM_7105 (ureB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Urease_beta
Motif
Other DBs
NCBI-ProteinID: BAC74816
NITE: SAV7105
UniProt: Q826S0
Position
8464852..8465163
Genome map
AA seq 103 aa AA seqDB search
MIPGEILFADGPVAYNEGREVTRLTVLNAADRPVQVGSHYHFAEANPGLDFDRAAARGKR
LNVAAGTAVRFEPGIPVDVELVPLAGARVVPGLRGETGGALDA
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgattcccggagagatcctcttcgccgacggacccgtcgcctacaacgagggccgcgag
gtcacccggctgaccgtcctcaacgccgccgaccggcccgtccaggtcggctcccactac
cacttcgccgaggccaaccccggtctggacttcgaccgcgccgccgcccgcggcaagcgg
ctcaacgtcgccgccggcaccgccgtgcgcttcgaacccggaatccccgtcgacgtcgaa
ctcgttccgctcgccggcgcccgcgtggtgcccgggctgcgcggggagaccggaggtgcc
ctcgatgcctga

DBGET integrated database retrieval system