KEGG   Streptomyces avermitilis: SAVERM_7177
Entry
SAVERM_7177       CDS       T00126                                 

Gene name
thcA
Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00620  Pyruvate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_7177 (thcA)
   00620 Pyruvate metabolism
    SAVERM_7177 (thcA)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     SAVERM_7177 (thcA)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: BAC74888
NITE: SAV7177
UniProt: Q826L1
Position
complement(8543834..8545357)
AA seq 507 aa
MTRFAAPGTDGAIVSYQARYDHFIGGEYVPPARGQYFENPSPVNGQPFTEIARGTAEDVE
RALDAAHAVAPAWGRTSVAERSDILRRIADRMEANLEKLAVAESWENGKPVRETLAADIP
LAIDHFRYFAGAIRAQEGSLGEVDDDTVAYHFHEPLGVVAQIIPWNFPILMATWKLAPAL
AAGNAVVLKPAEQTPASIHYWLSLVADLLPPGVLNIVNGFGVEAGKPLASSPRVAKVAFT
GETTTGRLIMQYASENITPVTLELGGKSPNIFFDDVWSANDDFRDKALEGFTMFALNQGE
VCTCPSRALVQRGQYAEFMEAAVARTELIKTGHPLDTDTMIGAQASNDQLEKILSYLDIG
RQEGAKILTGGERIEHDGELKGGYYVQPTIFEGDNRMRIFQEEIFGPVVSVTSFNDFDDA
IKIANDTLYGLGAGVWTRDINTAYRAGRAIQAGRVWTNCYHAYPAHAAFGGYKGSGIGRE
THKMMLDHYQQTKNLLVSYSPKKLGFF
NT seq 1524 nt   +upstreamnt  +downstreamnt
atgacccgtttcgcagcgcccggcaccgacggcgcgatcgtctcctaccaggcgcgctat
gaccacttcatcggcggcgagtacgtgccgccggcccgcggacagtacttcgagaacccg
agcccggtgaacgggcagccgttcacggagatcgcgcggggcacggccgaggacgtggag
cgcgcgctcgacgccgcgcacgcggtcgcccccgcctggggccgcacgtccgtggcggag
cgctccgacatcctccgccgcatcgccgaccggatggaggcgaacctggagaagctggcg
gtcgcggagagctgggagaacggcaaaccggtccgtgagacgctggccgcggacattccg
ctggccatcgaccacttccgctacttcgcgggcgcgatccgcgcgcaggagggttccctc
ggcgaggtcgacgacgacacggtcgcgtaccacttccacgagccgctcggcgtggtcgcg
cagatcatcccgtggaacttcccgatcctgatggcgacgtggaagctcgccccggccctc
gcggcgggcaacgcggtcgtcctcaagcccgccgaacagaccccggcgtccatccactac
tggctgagcctggtggccgacctgctgccgccgggcgtgctgaacatcgtcaacgggttc
ggggtggaggcgggcaaaccgctcgcgtccagcccgcgggtggcgaaggtggcgttcacc
ggcgagaccacgacggggcggctgatcatgcagtacgcctccgagaacatcaccccggtc
acgctcgaactcggcggcaagtccccgaacatcttcttcgacgacgtctggtcggcgaac
gacgacttccgtgacaaggcgctcgaaggcttcacgatgttcgccctcaaccagggcgag
gtgtgcacctgcccgtcccgggcgctcgtccagcgcggccagtacgccgagttcatggag
gcggcggtcgcccgcaccgagctgatcaagaccggtcacccgctcgacacggacacgatg
atcggcgcccaggcgtccaacgaccagctggagaagatcctctcctatctggacatcggc
cggcaggagggcgcgaagatcctcaccggcggcgaacgcatcgagcacgacggtgagttg
aagggcggttactacgtccagccgaccatcttcgagggcgacaaccgtatgcggatcttc
caggaggagatcttcggtccggtcgtctcggtgacgtcgttcaatgacttcgacgacgcc
atcaagatcgccaacgacacgctgtacgggctcggcgcgggcgtatggacgcgggacatc
aacaccgcgtaccgcgcgggccgtgccatccaggcgggccgcgtctggacgaactgctac
cacgcctacccggcccacgcggcgttcggcggctacaagggctcgggcatcggccgcgag
acccacaagatgatgctggaccactaccagcagacgaagaacctactggtgtcgtactcg
ccgaagaagctgggcttcttctag

DBGET integrated database retrieval system