KEGG   Streptomyces avermitilis: SAVERM_7249Help
Entry
SAVERM_7249       CDS       T00126                                 

Gene name
gnd3
Definition
(GenBank) putative 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
sma  Streptomyces avermitilis
Pathway
sma00030  Pentose phosphate pathway
sma00480  Glutathione metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01130  Biosynthesis of antibiotics
sma01200  Carbon metabolism
Module
sma_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sma_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SAVERM_7249 (gnd3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SAVERM_7249 (gnd3)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     SAVERM_7249 (gnd3)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     SAVERM_7249 (gnd3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 NAD_binding_11 Shikimate_DH F420_oxidored 3HCDH_N Glyco_transf_4 ApbA adh_short 2-Hacid_dh_C CHASE7
Motif
Other DBs
NCBI-ProteinID: BAC74960
NITE: SAV7249
UniProt: Q826E4
Position
complement(8642147..8643586)
Genome map
AA seq 479 aa AA seqDB search
MSTTAQIGVTGLAVMGRNLARNFARNGYTVAVHNRTASRTRDLVEEFGHEGDFVPAETAK
DFVAALERPRRLVIMVKAGAPTDAVIEEFAPLLEPGDMIIDGGNAHFADTRRRERELREQ
DIHFVGTGISGGEEGALHGPSIMPGGSPESYDSLGPMLEKISAKAADGAPCVTHVGPDGA
GHFVKMVHNGIEYADMQLIGEAYQLLRDVAGYTPAQIADIFRTWNTGRLDSYLIEITAEV
LSHVDAATGKPFVDVVQDQAEQKGTGRWTVQIALDLGVPVSGIAEAVFARSLSGHQELRE
ASRGLAGPKAAPLGESEAAAFADRVEQALYASKIVSYTQGFHEIAAGSDEYDWNIDLGKI
ASIWRGGCIIRAAFLDRIREAYDARADLPSLLSDDTFAQEIAAAQDDWREVLIAATRQGV
PTPGFAAALAYYDALRAERLPAALTQGQRDFFGAHTYRRTDREGSFHTLWGGDRSEVTA
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaacagcccagatcggcgtcactggtctcgcggtcatgggccgcaacctcgcc
cgcaacttcgcgcgcaacggctatacggtcgcggtgcacaaccggaccgcgtcgcggacg
cgtgacctcgtggaggagttcggccacgagggcgacttcgtgccggccgagaccgcgaag
gacttcgtggcggcgctggagcggcccaggcgcctggtgatcatggtgaaggcgggcgcg
cccaccgacgcggtgatcgaggagttcgccccgctcctggagcccggcgacatgatcatc
gacggtggcaacgcacacttcgcggacacccggcgccgggagcgcgagctgcgcgagcag
gacatccacttcgtcggcaccggcatctccggcggcgaggagggcgcgctgcacgggccg
agcatcatgccgggcggctcgcccgagtcgtacgactccctcgggcccatgctggagaag
atctccgcgaaggcggccgacggggcgccgtgcgtgacgcacgtcggtccggacggtgcc
gggcacttcgtgaagatggtgcacaacggcatcgagtacgcggacatgcagctgatcggc
gaggcgtaccagctgctgcgcgacgtcgccggctacacgcccgcgcagatcgcggacatc
ttccggacctggaacacgggccgcctcgactcctacctgatcgagatcacggcggaggtc
ctgtcccacgtggacgcggcgaccggcaagccgttcgtggacgtggtccaggaccaggcg
gaacagaagggcacgggccgctggacggtccagatcgcgctcgacctgggcgtgccggtg
tcgggcatcgcggaggccgtgttcgcccgctccctgtccggccaccaggagctgcgggag
gcctcgcgcgggctggccgggccgaaggcggctccgctcggcgagtcggaggcggcggcc
ttcgccgaccgcgtcgagcaggcgctgtacgcctcgaagatcgtctcgtacacgcagggc
ttccacgagatcgcggcgggcagcgacgagtacgactggaacatcgacctggggaagatc
gcgtcgatctggcggggcgggtgcatcatccgcgccgccttcctggaccgcatccgggag
gcgtacgacgcgcgtgcggacctgccgagcctgctgtccgacgacacgttcgcgcaggag
atcgcggcggcgcaggacgactggcgcgaggtgctgatcgcggcgacccgccagggcgta
ccgaccccggggttcgccgcggccctcgcctactacgacgccctgcgcgccgagcgcctg
cccgccgccctcacccaggggcagcgggacttcttcggggcgcacacctatcgccgcacg
gaccgggagggctcgttccacacgctgtggggcggggaccggtcggaggtcaccgcgtag

DBGET integrated database retrieval system