KEGG   Streptomyces avermitilis: SAVERM_7256
Entry
SAVERM_7256       CDS       T00126                                 

Gene name
tgs
Definition
(GenBank) putative triacylglycerol synthase
  KO
K00635  diacylglycerol O-acyltransferase / wax synthase [EC:2.3.1.20 2.3.1.75]
Organism
sma  Streptomyces avermitilis
Pathway
sma00561  Glycerolipid metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SAVERM_7256 (tgs)
Enzymes [BR:sma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.20  diacylglycerol O-acyltransferase
     SAVERM_7256 (tgs)
    2.3.1.75  long-chain-alcohol O-fatty-acyltransferase
     SAVERM_7256 (tgs)
SSDB
Motif
Pfam: WES_acyltransf WS_DGAT_C
Other DBs
NCBI-ProteinID: BAC74967
NITE: SAV7256
UniProt: Q826D7
Position
8652210..8653553
AA seq 447 aa
MTSDLLAPLDLAFWNIESAQHPMHLGALGVFSCHSPTAGAHAADLLASRAAAVPGLRMRI
RDVWQPLAFPLTFPLPFGGATREPAPDFDPLDHVRLHAPAADFHAVAGRLMQRPLERGRP
PWEAHVLPGEDGTSFAVLFKFHHALADGLRALMLAAALMDPMDMPTPRPRPAEPARGLLP
DVRKLPELLRGTLSDVGRALDIGASVARATLGARSSSALTSEPSGTRRTAGVLIDLDAVH
RVRKTVGGTVNDVLIAIVAGALRTWLDERGDGSAGVAPRALIPVSRRRPRTAHPQGNRLS
GYLIRLPVDDPDPLGRLRTVRMAMDRNKDAGPNRGAGAVALLADHVPPLGHRLGGPVVGQ
AARLLFDILVTSVPLPSLGLKLGGSPLTEVYPFAPLARGQSLAVAVSTYRGRVHYGLVAD
AKAVPDLGRLARAVTEEMETLLTVCGP
NT seq 1344 nt   +upstreamnt  +downstreamnt
ttgacctctgacctgctcgccccactcgacctggcgttctggaacatcgagtccgcccag
cacccgatgcacctcggcgccctcggcgtgttctcgtgccactcgcccaccgccggcgcc
cacgccgccgacctgctcgcctcccgcgccgccgcggtacccgggctgcgcatgcggatc
cgtgacgtctggcagccgctggccttcccgctgaccttcccgctcccgttcggcggcgcg
acccgcgagcccgcccccgacttcgacccgctcgaccacgtacgcctgcacgcgccggcc
gccgacttccacgccgtcgcgggccggctcatgcagcgcccactggagcgcggccggcca
ccgtgggaggcgcatgtactgcccggggaggacggcacgtcgttcgccgtgctcttcaag
ttccaccacgcgctggcggacggactgcgggcgctgatgctcgcggcggcgctcatggac
cccatggacatgccgacgccccgcccgcgtccggccgagcccgcgcgggggctcctcccg
gacgtgcgcaaactgccggagctgctgcgcggcaccctctccgacgtgggccgggccctc
gacatcggcgcctccgtcgcccgtgccaccctcggcgcacggtcgtcgtccgcgctcacc
tccgagcccagcggcacccgccgcaccgcgggcgtcctcatcgacctcgacgcggtgcac
cgcgtccgcaagaccgtcggcggcaccgtcaacgacgtactcatcgccatcgtcgcgggc
gccctgcgtacctggctggacgagcgcggcgacggcagcgcgggggtcgcgccccgcgcc
ctgatccccgtctccaggcgccgcccgcgcaccgcgcacccacagggcaaccggctctcc
ggttacctgatacggcttccggtcgacgaccccgatccgctcgggcggctgcgcacggtg
cgtatggcgatggaccgcaacaaggacgcggggcccaaccggggagcgggcgccgtggcg
ctgctcgccgaccacgtgccgccgctcggccaccggctgggcgggcccgtggtcggccag
gcggcccggctgctcttcgacatcctggtgaccagcgtgccgctgcccagcctcggcctg
aaactcggcggcagccccctcacggaggtctatccgttcgcccccctggcccgcgggcag
tccctcgcggtcgccgtctcgacgtaccgcggacgcgtccactacgggctcgtcgccgac
gccaaggccgtgccggacctcggccggctggcgcgtgcggtgaccgaggagatggagacg
ctgctcactgtctgcggcccctga

DBGET integrated database retrieval system