KEGG   Streptomyces avermitilis: SAVERM_7269
Entry
SAVERM_7269       CDS       T00126                                 

Gene name
amdA1
Definition
(GenBank) putative amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
sma  Streptomyces avermitilis
Pathway
sma00330  Arginine and proline metabolism
sma00360  Phenylalanine metabolism
sma00380  Tryptophan metabolism
sma00627  Aminobenzoate degradation
sma00643  Styrene degradation
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SAVERM_7269 (amdA1)
   00360 Phenylalanine metabolism
    SAVERM_7269 (amdA1)
   00380 Tryptophan metabolism
    SAVERM_7269 (amdA1)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SAVERM_7269 (amdA1)
   00643 Styrene degradation
    SAVERM_7269 (amdA1)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     SAVERM_7269 (amdA1)
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-ProteinID: BAC74980
NITE: SAV7269
UniProt: Q826C4
Position
complement(8668562..8669926)
AA seq 454 aa
MTSWVGLSAAEIAAAVREKRATPREVVAEHLARIDRLDARVGAFRRVRADAALAEADEVA
SRTDLAELPLAGVPVAVKDNLAVRGESTRHGSAATPDTPADHDHVTVARLRAAGAVVVGV
TNVPELCVFGTTDGVHGTARNPWDTSRTAGGSSGGSAAAVAAGMVPIALGNDGMGSLRIP
AANCGLVGLKPGYGTVPAGIGNGDWFGMSENGPLATTVEDARLMFAVLAGTVTAVAETEA
IRPSGPGTRTIALSVRSPLAGVAVGRPYASAAREAAELLAGAGHQVRRADPPYPLWLSTT
SLAHWTAGTAVDAEDLDVRRLTRRTRVHAAVGRRFVRSVRGGARREQLRERLTPFFEEHD
VLLTPALARRGPAAAAWHERGWLRNLLVNTTYSPLTPPWNLTGWPALSVPFGTLPSGAPG
AVQLVGRPGSELDLLALAGQLEELHPWRRTAPLG
NT seq 1365 nt   +upstreamnt  +downstreamnt
gtgaccagctgggtcggcctttccgccgccgagatcgccgcagccgtacgcgagaagcgg
gccacgccccgtgaggtggtcgccgaacacctcgcccggatcgaccggctcgacgcccgc
gtcggcgccttccgccgggtgcgcgcggacgcggccctggccgaggccgacgaggtggcg
tcccgcaccgacctggccgaactccccctggccggggtgcccgtggccgtgaaggacaat
ctcgccgtacggggcgagtccactcgccacggctccgcggccacccccgacaccccggcc
gaccacgaccatgtcacggtggcccggctgcgtgcggcgggtgccgtcgtcgtgggggtg
acgaacgtgcccgagctctgcgtgttcggcaccacggacggcgtgcacggcacggcccgc
aacccgtgggacacctcgcgcacggcgggcggctcctcggggggcagcgcggccgcggtc
gccgccgggatggtgccgatcgcgctcggcaacgacgggatgggctccctgcgcatcccc
gccgccaactgcggtctcgtcggcctgaagccggggtacgggacggtgccggcgggcatc
ggaaacggcgactggttcggcatgtccgagaacggcccgctcgcgaccacggtcgaggac
gcccggctgatgttcgcggtgctggccgggacggtcacggcggtcgcggagacggaggcg
atacgcccgtccgggcccggcacccgcacgatagccctctcggtccgcagtccgctggcc
ggtgtcgccgtcggccgcccgtacgcgtccgccgcccgggaggccgccgagttgctggcc
ggggccggtcaccaggtgcggcgtgccgatcccccgtaccccctgtggctgagcacgacc
tcgctcgcacactggacggcgggcaccgcggtggacgccgaggacctcgatgtacggcgg
ctgacccggcgcacgcgggtgcacgcggcggtggggcgccgctttgtgcgctcggtgcgg
ggcggcgcacgccgggagcagttgcgggagcgcctgacgccgttcttcgaggagcacgac
gtgctgctgacccccgccctcgcccggcgcggccccgccgcggcggcctggcacgagcgg
ggctggctgcgcaatctgctggtcaacaccacctactcgccgctgaccccgccctggaat
ctcacgggctggcccgccctgtcggttccgttcggcacactgccgagcggcgcgcccggt
gccgtgcagctggtgggacgccctggttccgagctcgatctcctcgccctggcgggccag
ttggaggaactgcacccctggcgacgcacggccccgctcggctga

KEGG   Streptomyces avermitilis: SAVERM_7345
Entry
SAVERM_7345       CDS       T00126                                 

Gene name
amdA2
Definition
(GenBank) putative amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
sma  Streptomyces avermitilis
Pathway
sma00330  Arginine and proline metabolism
sma00360  Phenylalanine metabolism
sma00380  Tryptophan metabolism
sma00627  Aminobenzoate degradation
sma00643  Styrene degradation
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SAVERM_7345 (amdA2)
   00360 Phenylalanine metabolism
    SAVERM_7345 (amdA2)
   00380 Tryptophan metabolism
    SAVERM_7345 (amdA2)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SAVERM_7345 (amdA2)
   00643 Styrene degradation
    SAVERM_7345 (amdA2)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     SAVERM_7345 (amdA2)
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-ProteinID: BAC75056
NITE: SAV7345
UniProt: Q825V3
Position
complement(8760992..8762506)
AA seq 504 aa
MSRMAAERADTPPERAEGLARCARALADGEVTSRELVERTLARIEATQPSLNAFRLVRAE
ASLAEAQAADRELAAGARRPLLGVPVAVKDDMDVAGEPTAFGCRGEFPPRAEDSEAVRRL
RAAGAVIVGKTNTCELGQWPFTEGPAFGATRNPWHPDHTPGGSSGGSAAAVAAGLVPAAL
GSDGAGSVRIPASWTHLVGIKPQRGRISTWPRPESFQGITVNGTLARTVADAALLLDAAS
GNHAGDLHRPPATGVLEAVGREPGRLRIALSLKPPFTALPARLDPRVRARVLELAERLAA
LGHVVEEAEPRYGRIGLTFVPRATAGLAEWVRDAPFPDLLDRRTRDAARLGRLLGGAPLR
LARAAEARLHRRVGALFDVYDVLLAPTTAAPPPHIGSMVNLNGFGTDRAMIAACPYAWPW
NVLGWPGVNVPAGFVDGGPSPAEGGRDGGLLPVGAQLLGPAHSEPLLVSLAAQLEADRRW
HEQWPPASTDADSAATRRSSGRTL
NT seq 1515 nt   +upstreamnt  +downstreamnt
gtgtcccgcatggctgccgaacgcgccgacacccctcccgagcgtgccgagggcctcgcc
cggtgcgcccgggccctggccgacggcgaggtgacctcgcgcgagctcgtcgagcggacg
ctggcccggatcgaggcgacgcagccctcgctgaacgcgttccggctggtgcgcgccgag
gcctcgctcgccgaggcacaggcggcggaccgggagctggcggcgggggcgcggcggccg
ctgctcggggtgccggtggcggtgaaggacgacatggacgtggcgggcgaaccgaccgcg
ttcggctgtcggggcgagttcccgccgcgggccgaggacagtgaggcggtacggcggctg
cgggcggccggggcggtgatcgtcggcaagaccaacacctgcgagctgggccagtggccg
ttcaccgaggggcccgctttcggcgccacccgcaatccctggcatccggaccacacgccg
ggcggttcctcgggcggctcggcggccgcggtcgccgcgggcctggtcccggccgccctg
ggctcggacggtgcgggttccgtccgcatcccggcctcctggacgcatctggtcggcatc
aaaccgcagcgcggccggatctccacctggccgcgccccgagtccttccagggcatcacg
gtcaacggaacgctcgcccgtacggtcgccgacgcggcgctgctcctggacgcggcgagc
ggcaaccacgcgggcgacctgcaccgcccgcccgccaccggcgtcctggaggccgtcggg
cgcgagccgggccggctgcggatcgccctctcgctcaagcccccgttcacggcgctgccc
gcccggctcgatccccgggtacgggcgcgggtcctcgagctggcggagcggctggcggcg
ctcgggcacgtggtcgaggaggcggagccgcgctacggccggatcggactgacgttcgtc
ccgcgggccacggccggcctggcggagtgggtgcgcgacgcgccgtttccggacctcctc
gaccggcgcacccgcgacgccgcccgcctcggccgactgctcggcggagcacccctgcgc
ctggcacgggcggcggaggccaggctgcaccggcgggtcggggcgctcttcgacgtgtac
gacgtactcctcgcgccgacgaccgccgctcccccgccgcacatcggctcgatggtgaac
ctgaacggtttcgggaccgaccgcgccatgatcgccgcctgcccctacgcctggccgtgg
aacgtgctgggctggccgggcgtcaacgtccccgccggtttcgtggacggcggcccctcc
ccggccgagggcggccgagacggcggactcctgcccgtgggcgcccagttgctgggcccg
gcgcacagcgaacccctgctcgtctcgctcgccgcccagctggaggcggaccggcgatgg
cacgaacagtggcctccggcctcgacggacgccgactcggcggcgacccggaggagttcg
ggccgtacgctgtga

DBGET integrated database retrieval system