KEGG   Streptomyces avermitilis: SAVERM_803
Entry
SAVERM_803        CDS       T00126                                 

Gene name
pgmA
Definition
(GenBank) putative phosphoglucomutase
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00030  Pentose phosphate pathway
sma00052  Galactose metabolism
sma00230  Purine metabolism
sma00500  Starch and sucrose metabolism
sma00520  Amino sugar and nucleotide sugar metabolism
sma00521  Streptomycin biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
Module
sma_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_803 (pgmA)
   00030 Pentose phosphate pathway
    SAVERM_803 (pgmA)
   00052 Galactose metabolism
    SAVERM_803 (pgmA)
   00500 Starch and sucrose metabolism
    SAVERM_803 (pgmA)
   00520 Amino sugar and nucleotide sugar metabolism
    SAVERM_803 (pgmA)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SAVERM_803 (pgmA)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SAVERM_803 (pgmA)
Enzymes [BR:sma01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     SAVERM_803 (pgmA)
SSDB
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Other DBs
NCBI-ProteinID: BAC68513
NITE: SAV0803
UniProt: Q82PR9
Position
complement(955607..957277)
AA seq 556 aa
MQHERAGTSAGPEDLIDVAKLVTAYYALHPDPAEPGQRVAFGTSGHRGSSLATAFNEDHI
AATSQAICEYRDSQGTNGPLFLGADTHALSEPARVTALEVFAANGVTVLIDSDDGYTPTP
AVSHAILTYNRGRASGLADGVVVTPSHNPPADGGFKYNPPSGGPAGSEATSWIQDRANEI
ITGGLKDVRRVPYTQALAAPGTGRYDFLGTYVADLPSVLDLDAIRAAGVRIGADPLGGAS
VAYWGRIAEQHGLDLTVVNPLTDPTWRFMTLDWDGKIRMDCSSPYAMASLIEQRDRYRIA
TGNDADADRHGIVTPDAGLMNPNHYLATAISYLYSHRERWPAGAGVGKTLVSSGMIDRVA
ADLGRRLVEVPVGFKWFVDGLADGSLGFGGEESAGASFLRRDGSVWTTDKDGILLALLAS
EITAVTDKTPSEHYAALTARFGEPAYARIDAPASREEKALLAKLSPAQVGADTLAGEPVT
AVLTRAPGNDAPIGGIKVTTDNAWFAARPSGTEDVYKIYAESFLGPDHLSQVQQEAKLVV
DAALGADAPGAGSDMA
NT seq 1671 nt   +upstreamnt  +downstreamnt
atgcagcatgagcgagcgggcacgtcggcgggacccgaggacctcatcgacgttgccaag
ctggtcacggcgtactacgcgctgcatcccgacccggccgaaccggggcagcgcgttgcg
ttcggcacctcgggacaccgcggatcgtcgctggcgacggcgttcaacgaggaccacatc
gccgcgaccagccaggccatctgcgagtaccgcgacagccagggcaccaacggccccctc
tttctgggcgccgacacccatgctttgtccgagccggccagagtcaccgcgcttgaggtg
ttcgcggccaacggcgtgaccgtgctcatcgacagcgatgacggctacacgcccactccg
gcggtctcgcacgccatcctcacctacaaccggggccgtgcctcgggcctcgctgacggt
gtggtggtcaccccctcgcacaatccgcccgccgacggaggcttcaagtacaacccgccg
agcggtggcccggcaggttccgaggcgacctcctggatccaggaccgggccaacgagatc
atcacgggcggcctcaaagacgtacggcgcgttccctacacccaggcgctcgccgcaccc
ggcaccggccggtacgacttcctgggcacctacgtcgccgatctgccgagtgtgctggac
ctggacgcgatccgcgcggcgggcgtacgtatcggtgccgatccgctgggcggggcttca
gtcgcctactggggccgcatcgccgaacagcacgggctcgacctgacggtcgtcaatcca
ctcacggaccccacctggcggttcatgacgctggactgggacggcaagatccgcatggac
tgctcgtcgccgtacgccatggcctcactcatcgagcagcgcgaccgctaccggatcgcc
acgggcaacgacgccgacgccgaccggcacggcatcgtcacgccggacgccgggctgatg
aatcccaaccactacctcgccaccgccatctcctacctgtactcccaccgggagcggtgg
cccgcgggcgccggggtcggcaagacattggtgtcgtccgggatgatcgaccgcgtcgcc
gcggacctcggccgccgactggtcgaagttcccgtggggttcaagtggttcgtggacggg
ctggccgacgggtcgctcggcttcgggggcgaggagtcggccggtgcgtccttcctgcgc
cgggacggctcggtgtggaccaccgacaaggacggcatcctcctggccctgctcgcctcc
gagatcacggcggtcaccgacaagacgccgtcggagcactacgccgcgctgaccgcccgc
ttcggtgagcccgcgtacgcgcgcatcgacgcccccgcgtcccgtgaggagaaggccctg
ctcgccaagctgtccccggcccaggtcggcgcggacaccctggccggggagccggtcacc
gcggtcctcacccgggcgccgggcaacgacgcgccaatcggcggcatcaaggtgaccacc
gacaacgcctggttcgcggcccgcccttcgggcaccgaggacgtctacaagatctacgcc
gagtcgttcctcggtcccgaccacctcagccaggtgcagcaggaggccaaactcgtggtc
gacgcggcgctgggggctgacgcgccgggtgcgggcagcgacatggcgtag

DBGET integrated database retrieval system