KEGG   Streptomyces avermitilis: SAVERM_875
Entry
SAVERM_875        CDS       T00126                                 

Gene name
pip
Definition
(GenBank) putative proline iminopeptidase
  KO
K01259  proline iminopeptidase [EC:3.4.11.5]
Organism
sma  Streptomyces avermitilis
Pathway
sma00330  Arginine and proline metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SAVERM_875 (pip)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sma01002]
    SAVERM_875 (pip)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.5  prolyl aminopeptidase
     SAVERM_875 (pip)
Peptidases and inhibitors [BR:sma01002]
 Serine peptidases
  Family S33
   SAVERM_875 (pip)
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr Abhydrolase_4
Other DBs
NCBI-ProteinID: BAC68585
NITE: SAV0875
UniProt: Q82PM7
Position
complement(1047772..1048737)
AA seq 321 aa
MAQPFPPVEPYAHGLLDVGDGNRIYWETSGSPDGKAALCVHGGPGGGGRRGSRRMFDPEV
YRIVLFDQRGCGESLPHASDPAVSLVHNTTEHLIADMERLREHLGIERWLLYGGSWGSTL
ILAYAERHPDRVSEIVIVGVTMTRPEETDWLYHGVGRLLPGPWEAFRDALPVADRDGNLV
AAYNRLLNSPDDAVRTKAARDWCAWEDAVIAHEALGKPGQYSDKPDDALMAFVRICAHYF
ADDAWLEDGQLLRDAHRLAGIPAVLIHGRLDLGSPLKTAWELSKAWPDAELKVIDDSGHT
GSPSMQDAILESTERFGKNGR
NT seq 966 nt   +upstreamnt  +downstreamnt
atggcccagccgttcccgcccgtcgaaccgtacgcgcacggcctcctcgatgtcggcgac
ggcaatcggatctactgggagaccagcggcagccccgacggaaaggcggccctgtgcgtg
cacggcggccctggcggcggaggacgccgcggcagccgcaggatgttcgaccccgaggtc
taccggatcgtcctgttcgaccagcgtggctgcggtgagagcctgccccacgcctccgac
ccggccgtcagcctcgtccacaacaccaccgaacacctcatcgccgacatggagcggctg
cgcgagcacctgggcatcgagcgctggctcctctacggcggctcttggggctccacgctg
attctcgcctacgcggagcgccaccccgatcgggtctcggagatcgtcatcgtcggcgtc
accatgaccagaccggaggagaccgactggctctaccacggtgtcggacgcctgctgccc
ggcccctgggaggcgttccgcgacgcgttgccggtggcggaccgggacggcaatctcgtg
gcggcctacaaccggttgctgaacagtcccgatgacgcggtccgaaccaaggctgcgcgg
gactggtgcgcttgggaggacgcggtcatcgcccacgaggcactcggcaagccgggccag
tacagcgacaaacccgacgatgcgctgatggccttcgtccggatctgcgcgcactacttc
gcggacgacgcctggctcgaagatggacaactgctgcgtgacgcacaccggctggccgga
atccccgcagtgctgatccacggccgactcgacctgggcagcccgctgaagaccgcgtgg
gagctgtcaaaagcttggccggatgcggagctcaaagtgatcgacgactccggtcatacg
ggcagcccctcgatgcaggacgcgatcctggagtcgactgagcggttcggcaagaacggg
cgctga

DBGET integrated database retrieval system