KEGG   Streptomyces avermitilis: SAVERM_939Help
Entry
SAVERM_939        CDS       T00126                                 

Gene name
aveA2
Definition
(GenBank) type I polyketide synthase AVES 2
  KO
K14371  type I polyketide synthase AVES
Organism
sma  Streptomyces avermitilis
Pathway
sma00522  Biosynthesis of 12-, 14- and 16-membered macrolides
sma01052  Type I polyketide structures
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01130  Biosynthesis of antibiotics
Module
sma_M00777  Avermectin biosynthesis, 2-methylbutanoyl-CoA/isobutyryl-CoA => 6,8a-Seco-6,8a-deoxy-5-oxoavermectin 1a/1b aglycone => avermectin A1a/B1a/A1b/B1b
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01052 Type I polyketide structures
    SAVERM_939 (aveA2)
   00522 Biosynthesis of 12-, 14- and 16-membered macrolides
    SAVERM_939 (aveA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:sma01008]
    SAVERM_939 (aveA2)
Polyketide biosynthesis proteins [BR:sma01008]
 Polyketide synthase (PKS)
  Modular type I PKS
   cis-AT PKS
    Avermectin PKS
     SAVERM_939 (aveA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 Ketoacyl-synt_C KR KAsynt_C_assoc PS-DH PP-binding Thiolase_N adh_short PKS_DE Epimerase GDP_Man_Dehyd Docking ACP_syn_III Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: BAC68649
NITE: SAV0939
UniProt: Q79ZN0
Position
1149787..1168506
Genome map
AA seq 6239 aa AA seqDB search
MQLANEAKLLEYLKRVTADLDRTRRRLYEVVEREQEPIAIVGMACRYPGGATSPTRLWHL
VKSQTDAIGEFPTDRGWNLEQLYDPDPDRSGTSYTRSGGFLYDAGDFDAAFFELSPREAL
AMDPQQRLLLETTWETFEQGGIDPRSMRGSRTGVFVGINPEDYTTGYTHQPSNAVEGYLL
TGSAASIASGRISYNFGLEGPAITIDTACSSSLVALHLACQALRSGECTMALAGGASVMA
TPFVFTEFSRQRGLAADGRCKAFSAAADGTGWSEGVGMLLVERLSDARRNGHRVLAVVRG
SAVNQDGASNGLTAPNGRSQVKVIRQALANAHLSPADVDAVEAHGTGTTLGDPIEAQALV
EAYGQDRPNGRPLWLGTLKSNIGHSMAAAGVGGVIKMVMALRNGLLPRTLHVDEPSPHVD
WSAGAVQLLTETVPWPGGEGRLRRAGVSSFGVSGTNAHVILEEAPAHNIPSDTPADDVPG
ESAADEDAGSGDEAAAGSPGVWPWLVSAKSQPALRAQAQALHAHLTDHPGLDLADVGYTL
AHARAVFDHRATLIAADRDTFLQALQALAAGEPHPAVIHSSAPGGTGTGEAAGKTAFICS
GQGTQRPGMAHGLYHTHPVFAAALNDICTHLDPHLDHPLLPLLTQDPNTQDTTTLEEAAA
LLQQTRYAQPALFAFQVALHRLLTDGYHITPHYYAGHSLGEITAAHLAGILTLTDATTLI
TQRATLMQTMPPGTMTTLHTTPHHITHHLTAHENDLAIAAINTPTSLVISGTPHTVQHIT
TLCQQQGIKTKTLPTNHAFHSPHTNPILNQLHQHTQTLTYHPPHTPLITANTPPDQLLTP
HYWTQQARNTVDYATTTQTLHQHGVTTYIELGPDNTLTTLTHDNLPNTPTTTLTLTHPHH
HPQTHLLTNLAKTTTTWHPHHYTHHHNQPHTHTHLDLPTYPFQHHHYWLQPPGKPSDPSP
SEGREQATTPSTPLRDVLVGKSPQERDEELLRLVRTHAAAVLGHATPEVIVPNKAFKELG
FDSLAAIQLRNRLLADVDLPLPATLIFDYPTPMALCQFLRAAIVGADTGTTTRLPLTAVP
ADEPIAIVGMACRYPGDVRTVDDLWQVVSGGHDAIGGFPTNRGWDLDTLYNPDPDHHGTS
YTRSGGFLYDAGNFDPDFFGISPREALAMDPQQRLLLETAWESIEHACINPDSLRGTPTG
VFAGLTYHDYAARFPTAPAGFEGYLGHGSAGSIASGRVAYALGLEGPALTVDTACSSSLV
ALHLACQALRSGECSMALAGGVTVMSTPAGFVEFSRQRGLAVDGRCKAFSAAADGTGWGE
GVGMLLVERLSDARRLGHRILAVVRGSAVNQDGASNGLTAPNGPSQERVIRLALANADLT
PADVDAVEAHGTGTTLGDPIEAQALLATYGQDRPGNEPLWLGSMKSNIGHAQAAAGVGGV
IKMVMALRNGLLPRTLHVDEPSPHVDWSAGAVQLLTETVPWPGGEGRLRRAGVSSFGVSG
TNAHVILEEAPAHNIPSDTPADDAPGEAAADDVPGEAAGDDAGTGGEATGPAAGSPGVWP
WLVSAKSQPALRAQAQALHAHLTDHPGLDLADVGYTLAHARAVFDHRATLIAADRDTFLQ
ALQALAAGEPHPAVIHSSAPGGTGTGEAAGKTAFICSGQGTQRPGMAHGLYHTHPVFAAA
LNDICTHLDPHLDHPLLPLLTQDPNTQDTTTLEEAAALLQQTPYAQPALFAFQVALHRLL
TDGYHITPHYYAGHSLGEITAAHLAGILTLTDATTLITQRATLMQTMPPGTMTTLHTTPH
HITHHLTAHENDLAIAAINTPTSLVISGTPHTVQHITTLCQQQGIKTKTLPTKNAFHSPH
TNPILNQLHQHTQTLTYHPPHTPLITANTPPDQLLTPHYWTQQARNTVDYATTTQTLHQH
GVTTYIELGPDNTLTTLTHHNLPNTPTTTLTLTHPHHHPQTHLLTNLAKTTTTWHPHHYT
HHHNQPHTHTHLDLPTYPFQHQHYWLESTQPGAGSGSGSGSGRAGTAGGTAEVESRFWDA
VARQDLETVATTLAVPPSAGLDTVVPALSAWHRHQHDQARINTWTYQETWKPLTLPTTHQ
PHQTWLIAIPETQTHHPHITNILTNLHHHGITPIPLTLNHTHTNPQHLHHTRQQAQNHTT
GPITGLLSLLALDETPHPHHPHTPTGTLLNLTLTQTHTQTHPPTPLWYATTNATTTHPND
PLTHPTQAQTWGLARTTLLEHPTHTAGIIDLPTTPTPHTLHHLTQTLTQPHHQTQLAIRT
TGTHTRRLTPTTLTPTHQPPTPTPHGTTLITGGTGALATHLTHHLTTHQPTQHLLLTSRT
GPHTPHAQHLTTQLQQKGIHLTITTCDTSNPDQLQQLLNTIPPQHPLTTVIHTAGILDDA
TLTNLTPTQLNNVLRAKAHSAHLLHQLTQHTPLNAFVLYSSAAATFGAPGQANYAAANAY
LDALAHHRHTHHLPATSIAWGTWQGNGLATGQVSEHLRRRGMFAMPPELAVTAVDGAIAS
GRPSLLVADIDWKKLGPVLSSKSSVLLEDLPQAQGTEEARSTVEQTESTNLRQLLMGRSR
SEQEEELLSLVRIHSAAVLGRDDSEAIPPGRLFRDLGFDSLAAVELRNHLAAQTELALPT
TLVFDYPSPTKLAQFLLSEIAEFQPDNSTPLPRPRAELDEPIAIVGMACRFPGGVTSADD
FWDLISSEQDAIGGFPTDRGWDLDTLYDPDPDHPGTCYTRNGGFLYDAGHFDAEFFGISP
REALAMDPQQRLLLETAWETIEHAGINPHTLHGTPTGVFTGTNGQDHAAHIRQAPSGTEG
FVLTGAATSIASGRISYILGLEGPAVTLDTACSSSLVALHLACQSLRSGECTMALAGGAT
VMTTPITFTEFARQRGLAPDGRCKAFSAAADGTGWGEGVGMLLVERLSDARRNGHRVLAV
VRGSAVNQDGASNGLTAPNGPSQQRVIRQALANADLTPADVDAVEAHGTGTTLGDPIEAQ
AILATYGQDRPGNGPLWLGSVKSNVGHTQAAAGVAGVIKMVMALRHRTLPPTLHADEPSP
HVDWSAGAVQLLTETVPWPGGEGRPRRAGVSSFGVSGTNAHVILEEAPADDVPGGPPADE
DAGSGEEAAAGSPGVWPWLVSAKSQPALRAQAQALHAHLTDHPGLDLADVGYTLAHARAV
FDHRATLIAADRDTFLQALQALAAGEPHPAVIHSSAPGGTGTGEAAGKTAFICSGQGTQR
PGMAHGLYHTHPVFAAALNDICTHLDPHLDHPLLPLLTQNDNDNDNEDAAALLQQTPYAQ
PALFAFQVALHRLLTDGYHITPHYYAGHSLGEITAAHLAGILTLTDATTLITQRATLMQT
MPPGTMTTLHTTPHHITHHLTAHENDLAIAAINTPTSLVISGTPHTVQHITTLCQQQGIK
TKTLPTNHAFHSPHTNPILNQLHQHTQTLTYHPPHTPLITANTPPDQLLTPHYWTQQARN
TVDYATTTQTLHQHGVTTYIELGPDNTLTTLTHHNLPNTPTTTLTLTHPHHHPQTHLLTN
LAKTTTTWHPHHYTHHHNQPHTHTHLDLPTYPFQHHHYWLELPSAQTSPGQRRSRRSAPD
TAESEFWDAVNEEDLQSLAETLDIDASALDTVVPALSAWHRHQHDQARINTWTYQETWKP
LTLPTTHQPHQTWLIAIPETQTHHPHITNILTNLHHHGITPIPLTVNHTHTNPQHLHHTL
HHTRQQAQNHTTGPITGLLSLLALDETPHPHHPHTPTGTLLNLTLPQTHTQTHPPTPLWY
ATTNATTTHPNDPLTHPTQAQTWGLARTTLLEHPTHTAGIIDLPTTPTPHTLHHLTQTLT
QPHHQTQLAIRTTGTHTRRLTPTTLTPTHQPPTPTPHGTTLITGGTGALATHLTHHLTTH
QPTQHLLLTSRTGPHTPHAQHLTTQLQQKGIHLTITTCDTSNPDQLQQLLNTIPPQHPLT
TVIHTAGVNLFAPVSETDAESFSSVTAAKATGAAILHELLLDHETLEHFILFSSGAGAWG
SGNQCAYSAANAYLDALATHRQTHGLPGASIAWGPWAGKGMSAGDAAHGYLEKRGILPME
PRMALAAFHRARAQRPNSNLIIADIDWERFVPAFTARRHSPLIEDIPEVRQAAQELEAAA
STAKTTTAQPIATSLRERLARLTSSKQNQVLLGLIRTGICTVLGLRNPEGIEDQRAFRDL
GFDSLTSAQFSKELAKETGLPLPPSLVFDYPTPQECAAHLRTQLVDLDDEEDAALSNALP
QVAHRRTVEDEPIAIIGMACRFPGGVRSADDLWELLASGKDAIGVFPTDRGWDLDTLYDP
DPDHPGTCYTRNGGFLYGAGHFDAEFFGISPREALAMDPQQRLLLETAWETIEHAGINPH
TLHGTPTGVFAGINAQDHAAHIRQSRDVETIEGYALTGSSGSVASGRVAYTLGLEGPAVS
VDTACSSSLVALHWAAQALRAGECSMALAGGVTVMSSPGTFVEFSRQRGLAADGRCKAYS
AAADGTGWAEGVGMLLVERLSDARRNGHRVLAVVRGSAVNQDGASNGLTAPNGPSQQRVI
RQALANAGLTPADVDAVEGHGTGTTLGDPIEAQALLAAYGQHRPHHRPLWLGSLKSNIGH
AQAAAGVGGVIKMVMALRNGLLPQTLHVDEPTPQVDWSTGAVQLLTQPVPWPADPAGRPR
HAGVSSFGVSGTNAHIILEEAPTPQDSDTDDEPPANAPALPHPLPLPVPVSARSEAGLRA
QAQALRQYVAARPDMSPADIGAGLARGRAVLEHRAVILAADREELAQALTALAAGEPHPH
ITTGHTRGGDRGGVVFVFPGQGGQWAGMGLTLLTSSPVFAEHIDACEKALTPWVPWSLTD
ILHRDPDDPAWQQADVVQPVLFSIMVSLAALWRSYGIEPDAVLGHSQGEIAAAHICGALS
LKDAAKTVALRSRALAAVRGRGAMASLPLPAQDVQQLISERWEGQLWVAALNGPHSTTVS
GDTKAVDEVLAHCTDTGLRAKRIPVDYASHCPHVQPLHDELLHLLGDITPQPSTVPFFST
VEGTWLDTTTLDAAYWYRNLHQPVRFSHAIQTLTDDGHRAFIEISPHPTLVPAIEDTTEN
TTENITATGSLRRGDNDTHRFLTALAHTHTTGIGTPTTWHHHYTQTHPHPNPHTHLDLPT
YPFQHQHYWLQPPTTTTDLTTTGLTPTHHPLLTATLTLADNNTQLLTGRLSLRTHPWLTD
HTVAGMVLLPGTALLELALQAGERVDCPRVEELTLHAPLVIPHTEDVTLQVTVRAADESG
HRALAIHSYSGTASSADREWTRHATGLLTHHADTDHRADTHTDACLGGSWPPPGAQPIEL
GDVYGRMAADSDIAYGPVFQGLHAAWRFGDDVLAEVRLPEEALRDAPAAAFGVHPALLDA
ALHATALTPQNGDGSTENVAQESMPDRAAHQARLPFSWSGVSLHTAGSSVLRVRLSRSPQ
HGNAVALTAADEDGRPVVTIESLALRPVSTEELRAAADRTPEHESLFRLDWVSVPVPANA
PSPTADRPWAVIGAGLPHLPGLTEHEHVTAYDEPADLLLALDRGAPPPGVLVVGGVAHTE
AREYSAEAPGERGTEACEARPDVVHVGVVHTAAVHAAAAQMLARLQAWLGDERLADSRLL
VLTCGAVARASGDDATDLPGAAVWGLVRSAQSEHPDRITLLDFERGTEAEPGQLATALNC
GERQLAVRPGGLFTPRLVRAPRVADAVPAVPAVAVPSAGHAAVPAAGPFLPGGTVLITGG
TGVLGRLVARHLVEAHGVRHLLLAGRRGPDAEGAPELRAELGGLGATVEVVACDAADRQQ
LADLLTRIPDDRPLTGVVHSAGILDDGVITSLSPERLGAVLRAKADAALLLDELTRGAEL
SAFVMFSSASAVVGSPGQGNYAAANAVLDFLAHRRRAEGLPAVSLAWGLWEEGTGMTGHL
DVDDHARISRAGMRPLPTAEALALFDAALADGEPFLMPARLDLTAVRSGAASAPVPPLLQ
GLLQLPRSRSAAAAPGHGAPAADEAAAWRERLARQSAGERRQALLRLVRSHVAAVLGHSG
ADGIDASRAFRELGFDSLTAVELRNRLTAATGLRLRATLAFDFPTPAALAEHLGERLLPD
QEATGEQAGDQLSGGSEEDVRSLLTSIPIGRLRDAGLLGPLLTLADTGRGASGAAAGPED
APPSGQDTPAPVSIDEMDIDDLMDLAHGHGTAPAREPADAEDSSSSRNRTHHTHEGETA
NT seq 18720 nt NT seq  +upstreamnt  +downstreamnt
atgcaattggcgaatgaagcgaagctcctggaatacctcaagcgcgtcactgcggacctg
gaccgcactcgccgtcgcctgtacgaggtggtcgagcgtgagcaggagccgatcgcgatt
gtggggatggcgtgtcgttacccaggcggggcgacgtcacccacgcgactgtggcatctc
gtcaagtcccagacggacgctatcggggagttcccgaccgaccgtggatggaacctggag
cagctctacgacccggaccccgaccgctcaggaaccagttacacgcgcagcggagggttt
ctctatgacgcgggcgacttcgacgccgcgttcttcgagttgtcaccgcgtgaggcgctg
gcaatggacccgcagcagcgcctgctgctcgaaaccacttgggaaacgttcgaacagggc
ggaatcgacccgaggtccatgcgcggaagccggaccggggttttcgtggggatcaatccg
gaggactacaccaccggatacacacatcagccctcaaacgcagtcgagggctacctgctc
actggcagcgcggcaagcattgcgtcaggccgtatctcctacaacttcgggctcgaaggc
cctgcgatcactatcgacaccgcgtgttcctcctcgctcgtcgccctgcatctggcctgc
caagcgctccggtccggtgaatgcaccatggcgctcgcaggcggcgcctccgtcatggcc
actcccttcgtcttcaccgagttctctcgccagcggggcctggccgcagacggccggtgc
aaggcgttttcggcggcggcggacgggaccggctggtccgagggtgtggggatgctgctg
gtggagcggctctccgacgcccgccgcaacggtcaccgtgtcctggccgtcgtccgcggc
agcgccgtcaaccaggacggcgcaagcaacggcctgaccgcacccaacggtcgttcacaa
gtcaaggtcatccgccaggctttggccaacgcacacctctcccctgccgatgtcgatgcg
gtggaggcccacggcacggggaccaccctgggcgacccgatcgaggctcaagccctcgtc
gaagcctacggtcaggaccgccccaacggccgccccctctggctcggaaccctcaagtcc
aacatcgggcactccatggccgctgcgggtgtgggcggggtcatcaagatggtgatggcg
ctgcggaatggtctgctgccgcggacgttgcatgtggatgagccgtcgccgcatgtggac
tggtccgcgggtgcggtgcagctgctgacggagacggtgccctggcccggcggggagggg
cggctacggcgggcaggagtgtcatcattcggcgtcagcggcaccaacgcccacgtcatc
ctcgaggaagcacccgcccacaacatcccgtcagacacacccgccgacgacgtcccggga
gaatcagccgccgacgaggatgccggtagtggcgatgaggctgctgccggcagtccaggg
gtgtggccgtggctggtgtcggccaagtcgcagccggccctgcgcgcccaggcccaggcc
ctgcacgcccacctcaccgaccaccccggcctcgacctcgccgacgtcgggtacaccctc
gcccacgcccgcgccgtgttcgaccaccgcgccaccctcatcgccgccgaccgcgacacc
ttcctgcaagcactccaggcactcgccgcaggcgaaccccaccccgccgtcatccacagc
agcgccccaggcgggaccgggaccggggaggccgcaggaaagaccgcattcatctgctcc
ggacagggcacccaacgccccggcatggcccacggcctctaccacacccaccccgtcttc
gccgccgcactcaacgacatctgcacccacctcgacccccacctcgaccaccccctcctc
cccctcctcacccaggaccccaacacccaggacaccaccaccctcgaagaagcggccgca
ctgctccagcagacccgctacgcccagcccgccctcttcgccttccaggtcgccctccac
cgcctcctcaccgacggctaccacatcaccccccactactacgccggacactccctcggc
gaaatcaccgccgcccacctcgccggcatcctcaccctcaccgacgccaccaccctcatc
acccaacgcgccaccctcatgcaaaccatgccccccggcaccatgaccaccctccacacc
accccccaccacatcacccaccacctcaccgcccacgaaaacgacctcgccatcgccgcc
atcaacacccccacctccctcgtcatcagcggcaccccccacaccgtccaacacatcacc
accctctgccaacaacaaggcatcaaaaccaaaaccctccccaccaaccacgccttccac
tccccccacaccaaccccatcctcaaccaactccaccagcacacccaaaccctcacctac
cacccaccccacacccccctcatcaccgccaacaccccacccgaccaactcctcaccccc
cactactggacccaacaagcccgcaacaccgtcgactacgccaccaccacccaaaccctc
caccaacacggcgtcaccacctacatcgaactcggacccgacaacaccctcaccaccctc
acccacgacaacctccccaacacccccaccaccaccctcaccctcacccacccccaccac
cacccccaaacccacctcctcaccaacctcgccaaaaccaccaccacctggcacccccac
cactacacccaccaccacaaccaaccccacacccacacccacctcgacctccccacctac
cccttccaacaccaccactactggctccaaccacccggcaagccgagcgacccgtcaccg
agcgaaggccgtgagcaagccacgaccccatcaaccccgctgcgtgatgtcctcgtgggc
aagtctccgcaggagcgagacgaagagctgttgcgcctggtgcgcacccatgcggccgct
gtgctgggccatgccactcccgaagtgatcgttccgaacaaggccttcaaagagctgggt
tttgattctctcgccgcaattcagcttcgtaatcgactgcttgctgacgttgacctgccg
cttccggccacgctgatcttcgattaccccactccgatggcgctttgccagttcctccgg
gcggcgatcgtcggagcggacacaggcacgaccactcgtctgccgctaactgcggtcccc
gccgacgagccgatcgccatcgtcggcatggcctgtcggtaccccggtgatgtacggacg
gtcgatgatctctggcaggtggtcagtggtggccatgacgcgatcggcggattcccgacg
aaccgtgggtgggacctcgacacgctgtacaacccggacccggaccaccacggaaccagc
tacacccggagcggcggattcctttacgacgcaggcaatttcgatcccgacttcttcggt
atcagtccgcgtgaggcactggcgatggacccgcagcagcggctgctgctggaaacagcg
tgggagagcatcgaacacgcctgcatcaaccccgacagcctccgtggcacaccaaccggc
gtcttcgccgggctgacctaccacgactacgccgcgcgctttcccacagctccggcaggg
ttcgaggggtatctcgggcacggaagcgcaggcagtatcgcctcgggtcgtgtcgcctac
gctctcggcctggaaggtccggccctcacagtcgacactgcctgctcttcgtccctggtc
gctctgcacctggcctgtcaggcgctgcggtccggcgagtgttccatggccctcgcgggt
ggcgtcacggtgatgtcaaccccggccgggttcgtggagttttcgcggcagcggggcctg
gccgtggacgggcggtgcaaggcgttctcggcagcggctgacggcaccggctggggtgag
ggtgtcggaatgctgctggtggagcggctgtcggacgcgcggcggctcggtcaccgaatc
ctcgcggtggtgcgtggcagtgcggtcaatcaggacggtgcgagcaacgggctgacggcg
cccaacgggccgtcccaggagcgtgtcatccgcctggccctggccaacgcggacctgacc
cccgccgacgtcgatgcggtggaggcccacggcaccggcaccactttgggcgacccgatc
gaggcccaggccctcctcgccacctacggacaggaccgccccggcaacgaaccgctgtgg
ctgggctcgatgaagtcgaacatcggccacgcgcaggctgccgcaggtgtgggcggggtc
atcaagatggtgatggcgctgcggaatggtctgctgccgcggacgttgcatgtggatgag
ccgtcgccgcatgtggactggtccgcgggggcggtgcagctgctgacggagacggtgccc
tggcccggcggggaggggcggctgcggcgggcaggagtgtcatcgttcggcgtcagcggc
accaacgcccacgtcatcctcgaagaagcacccgcccacaacatcccgtcagacacaccc
gccgacgacgccccgggagaagcagccgccgacgatgttccgggggaagcggccggcgac
gacgccggtaccggcggggaagcgactggtcctgctgccggcagtccaggggtgtggccg
tggctggtgtcggccaagtcgcagccggccctgcgcgcccaggcccaggccctgcacgcc
cacctcaccgaccaccccggcctcgacctcgccgacgtcgggtacaccctcgcccacgcc
cgcgccgtgttcgaccaccgcgccaccctcatcgccgccgaccgcgacaccttcctgcaa
gcactccaggcactcgccgcaggcgaaccccaccccgccgtcatccacagcagcgcccca
ggcgggaccgggaccggggaggccgcaggaaagaccgcattcatctgctccggacagggc
acccaacgccccggcatggcccacggcctctaccacacccaccccgtcttcgccgccgca
ctcaacgacatctgcacccacctcgacccccacctcgaccaccccctcctccccctcctc
acccaggaccccaacacccaggacaccaccaccctcgaagaagcggccgcactgctccag
cagaccccgtacgcccagcccgccctcttcgccttccaggtcgccctccaccgcctcctc
accgacggctaccacatcaccccccactactacgccggacactccctcggcgaaatcacc
gccgcccacctcgccggcatcctcaccctcaccgacgccaccaccctcatcacccaacgc
gccaccctcatgcaaaccatgccccccggcaccatgaccaccctccacaccaccccccac
cacatcacccaccacctcaccgcccacgaaaacgacctcgccatcgccgccatcaacacc
cccacctccctcgtcatcagcggcaccccccacaccgtccaacacatcaccaccctctgc
caacaacaaggcatcaaaaccaaaaccctccccaccaaaaacgccttccactccccccac
accaaccccatcctcaaccaactccaccagcacacccaaaccctcacctaccacccaccc
cacacccccctcatcaccgccaacaccccacccgaccaactcctcaccccccactactgg
acccaacaagcccgcaacaccgtcgactacgccaccaccacccaaaccctccaccaacac
ggcgtcaccacctacatcgaactcggacccgacaacaccctcaccaccctcacccaccac
aacctccccaacacccccaccaccaccctcaccctcacccacccccaccaccacccccaa
acccacctcctcaccaacctcgccaaaaccaccaccacctggcacccccaccactacacc
caccaccacaaccaaccccacacccacacccacctcgacctccccacctaccccttccaa
caccagcactactggctcgaaagcacacagccgggtgccggatccggttcgggttccggt
tccgggcgggcagggactgcgggcgggacggcagaggtggagtcgcggttctgggacgcg
gtggcccgccaggacctggaaacggtcgcgaccacgctcgccgtgcccccctccgccggc
ctggacacggtggtgcccgcactctccgcctggcaccgccaccaacacgaccaagcccgc
atcaacacctggacctaccaggaaacctggaaacccctcaccctccccaccacccaccaa
ccccaccaaacctggctcatcgccatccccgaaacccagacccaccacccccacatcacc
aacatcctcaccaacctccaccaccacggcatcacccccatccccctcaccctcaaccac
acccacaccaacccccaacacctccaccacacccgacaacaagcccaaaaccacaccacc
ggacccatcaccggcctgctctccctcctcgccctcgacgaaacaccccacccccaccac
ccccacacacccaccggcaccctcctcaacctcaccctcacccaaacccacacccaaacc
cacccaccaacccccctctggtacgccaccaccaacgccaccaccacccaccccaacgac
cccctcacacaccccacccaagcccaaacctggggactcgcccgcaccaccctcctcgaa
caccccacccacaccgccggaatcatcgacctccccaccacccccaccccccacaccctc
caccacctcacccaaaccctcacccaaccccaccaccaaacccaactcgccatccgcacc
accggcacccacacccgccgcctcacccccaccaccctcacccccacacaccaaccaccc
acccccaccccccacggaaccaccctcatcaccggcggaaccggcgccctcgccacccac
ctcacccaccacctcaccacccaccaacccacccaacacctcctcctcaccagccgaacc
ggcccccacaccccccacgcacaacacctcaccacccaactccaacaaaaaggcatccac
ctcaccatcaccacctgcgacaccagcaacccagaccaactccaacaactcctcaacacc
atccccccacaacaccccctcaccaccgtcatccacaccgcaggcatcctcgacgacgcc
accctcaccaacctcacccccacccaactcaacaacgtcctccgcgccaaagcccacagc
gcccacctcctccaccaactcacccaacacacccccctcaacgccttcgtcctctactcc
tccgccgccgccaccttcggcgcacccggccaagccaactacgccgcagccaacgcctac
ctcgacgccctcgcccaccaccgccacacccaccacctccccgccaccagcatcgcctgg
ggcacctggcaaggaaacggactggcgactggtcaagtcagcgaacatctccgccgccgc
gggatgttcgccatgccgcccgagttggcggtcacagctgttgacggcgcgatcgcgagc
gggcgcccgagtctcctcgtcgccgatatcgactggaagaaattgggaccggttctctcc
agcaagtcgtcggtcttgctcgaggaccttccccaggcacagggaactgaggaggcgcgc
agtaccgttgagcagacggagagcacaaacctccggcaactcctcatgggtcggtcacgt
tccgagcaggaagaagagctgctcagcctcgtccgcatccactccgcggcagtgctcggg
cgcgacgactccgaggccatcccgcccggtcggctgttcagggatctagggttcgactcg
cttgcggcggtggagcttcgcaaccacctcgcagcacagacggagctggctctgccgacg
actctcgtcttcgattaccccagccccaccaagctcgcccaatttctgctctccgagatc
gcggagttccagcccgacaactcaactccgcttccgcgaccccgggcagagctcgatgag
ccgatcgccatcgttggcatggcctgtcgcttccccggcggagtgacctcggcggacgac
ttctgggatctgatctcctccgagcaggacgcgatcggcggattccccaccgaccgcggc
tgggacctggacacgctctacgaccccgaccccgaccaccccggcacctgctacacccga
aacggcggattcctctacgacgcaggccacttcgacgccgaattcttcggcatcagcccc
cgcgaagccctcgccatggacccccagcaacgactcctcctcgaaaccgcctgggaaacc
atcgaacacgccggcatcaacccccacaccctccacggcacccccaccggagtcttcacc
ggcaccaacggacaggaccacgcggcacacatccgtcaggccccgagcggtaccgaggga
ttcgtcctgaccggggcagccaccagcatcgcctccggccgaatctcctacatcctcggg
ttggaagggcctgcggtcaccctcgacacagcgtgttcctcctcgctcgtcgccctgcac
ctcgcctgccagtccctcaggtccggtgaatgcaccatggccttggccggcggggccacg
gtcatgaccaccccgatcaccttcaccgaattcgcccgccaacgcggactcgcccccgac
gggcgttgcaaggcgttctcggcggcggctgacggtaccggctggggtgagggtgtgggg
atgctgctggtggagcggctctccgacgcccgccgcaacggtcaccgtgtcctggccgtg
gtgcgtggcagtgcggtcaaccaggacggtgcgagcaacggtctgaccgcgcccaacggg
ccctcccagcagcgcgtcatccgccaggccctcgccaacgcggacctgacccccgccgac
gtcgatgcggtggaggcccacggcaccggcaccactttgggcgacccgatcgaggcccag
gccatcctcgcgacctacggacaggaccgtcccggcaacgggccgttgtggctgggctcc
gtcaagtccaacgtcggacacacacaggccgcggcgggcgtggccggagtgatcaagatg
gtgatggccctccgccaccggacactcccaccgactctccacgcggatgagccgtcgccg
catgtggactggtccgcgggtgcggtgcagctgctgacggagacggtgccctggcccggc
ggggaggggcggccgcggcgggcaggagtgtcatcattcggcgtcagcggcaccaacgcc
cacgtcatcctcgaagaagcacccgccgacgacgttccggggggaccacccgccgacgag
gatgccggtagtggcgaggaggctgctgccggcagtcctggggtgtggccgtggctggtg
tcggccaagtcgcagccggccctgcgcgcccaggcccaggccctgcacgcccacctcacc
gaccaccccggcctcgacctcgccgacgtcggatacaccctcgcccacgcccgcgccgtg
ttcgaccaccgcgccaccctcatcgccgccgaccgcgacaccttcctgcaagcactccag
gcactcgccgcaggcgaaccccaccccgccgtcatccacagcagcgccccaggcgggacc
gggaccggggaggccgcaggaaagaccgcattcatctgctccggacagggcacccaacgc
cccggcatggcccacggcctctaccacacccaccccgtcttcgccgccgcactcaacgac
atctgcacccacctcgacccccacctcgaccaccccctcctccccctcctcacccaaaac
gacaacgacaacgacaacgaggacgcggccgcactgctccagcagaccccgtacgcccag
cccgccctcttcgccttccaggtcgccctccaccgcctcctcaccgacggctaccacatc
accccccactactacgccggacactccctcggcgaaatcaccgccgcccacctcgccggc
atcctcaccctcaccgacgccaccaccctcatcacccaacgcgccaccctcatgcaaacc
atgccccccggcaccatgaccaccctccacaccaccccacaccacatcacccaccacctc
accgcccacgaaaacgacctcgccatcgccgccatcaacacccccacctccctcgtcatc
agcggcaccccccacaccgtccaacacatcaccaccctctgccaacaacaaggcatcaaa
accaaaaccctccccaccaaccacgccttccactccccccacaccaaccccatcctcaac
caactccaccagcacacccaaaccctcacctaccacccaccccacacccccctcatcacc
gccaacaccccacccgaccaactcctcaccccccactactggacccaacaagcccgcaac
accgtcgactacgccaccaccacccaaaccctccaccaacacggcgtcaccacctacatc
gaactcggacccgacaacaccctcaccaccctcacccaccacaacctccccaacaccccc
accaccaccctcaccctcacccacccccaccaccacccccaaacccacctcctcaccaac
ctcgccaaaaccaccaccacctggcacccccaccactacacccaccaccacaaccaaccc
cacacccacacccacctcgacctccccacctaccccttccaacaccaccactactggctc
gaactacccagcgcccaaaccagccccggtcaaaggcgttctcgccgctcggctccagac
accgccgagtcggagttctgggacgcggtgaacgaggaagacctccagagcctcgccgaa
accctcgacatcgacgcctctgctctggacacggtggtgcccgcactctccgcctggcac
cgccaccaacacgaccaagcccgcatcaacacctggacctaccaggaaacctggaaaccc
ctcaccctccccaccacccaccaaccccaccaaacctggctcatcgccatccccgaaacc
cagacccaccacccccacatcaccaacatcctcaccaacctccaccaccacggcatcacc
cccatccccctcactgtcaaccacacccacaccaacccccaacacctccaccacaccctc
caccacacccgacaacaagcccaaaaccacaccaccggacccatcaccggcctgctctcc
ctcctcgccctcgacgaaacaccccacccccaccacccccacacacccaccggcaccctc
ctcaacctcaccctcccccaaacccacacccaaacccacccaccaacccccctctggtac
gccaccaccaacgccaccaccacccaccccaacgaccccctcacacaccccacccaagcc
caaacctggggactcgcccgcaccaccctcctcgaacaccccacccacaccgccggaatc
atcgacctccccaccacccccaccccccacaccctccaccacctcacccaaaccctcacc
caaccccaccaccaaacccaactcgccatccgcaccaccggcacccacacccgccgcctc
acccccaccaccctcacccccacacaccaaccacccacccccaccccccacggaaccacc
ctcatcaccggcggaaccggcgccctcgccacccacctcacccaccacctcaccacccac
caacccacccaacacctcctcctcaccagccgaaccggcccccacaccccccacgcacaa
cacctcaccacccaactccaacaaaaaggcatccacctcaccatcaccacctgcgacacc
agcaacccagaccaactccaacaactcctcaacaccatccccccacaacaccccctcacc
accgtcatccacaccgcaggcgtcaatctcttcgcccccgtgtcggaaaccgatgccgaa
tccttctcttccgttacggcagcgaaggcaacgggcgcggcgattctgcatgagttgctg
ctggaccatgaaacgcttgaacacttcattctcttctcgtcgggcgccggcgcttggggc
agcgggaatcagtgcgcatactcggcggccaacgcatacctggacgcgctcgcgacgcat
cgtcagacacatggacttcccggggcatcgatcgcctggggcccctgggccggaaagggc
atgtcggccggtgatgcggctcatggttacctggaaaagcgcggcattctgccgatggag
ccacgcatggcgctcgcggcattccatcgtgcgcgggcgcagcggccgaattccaacctg
atcatcgcggacatcgactgggagcgcttcgtccccgccttcaccgctcgacgccacagc
ccgctcatcgaggacattccggaggttcggcaagcggctcaggagctggaagcagctgcg
tcgacggcaaagacgaccacagctcagccgattgcgacgtctctccgtgagcgattggcc
cgactgacgtcctcaaagcagaaccaggtgctgctcggcctgattcggacaggcatctgc
accgttctcggccttcgtaatccggaaggcatcgaggaccaacgagccttccgcgacctc
ggcttcgactcgctgacgtcggctcagttcagcaaggaactcgccaaggaaaccggactg
ccactccccccgtccctggtcttcgactatcccaccccgcaggaatgtgctgcccatctg
cgcacacaactcgtcgacctagacgacgaagaggacgcggcactgtcgaatgctctcccg
caagtggcccatcggcgtaccgtcgaggacgaaccgatcgccatcatcggtatggcatgt
cgcttccccggcggcgtacgttctgccgacgacctgtgggaattgctcgcttcgggtaag
gacgctatcggcgtcttcccgaccgaccgcggctgggacctggacacgctctacgacccc
gaccccgaccaccccggcacctgctacacccgaaacggcggattcctctacggcgcaggc
cacttcgacgccgaattcttcggcatcagcccccgcgaagccctcgccatggacccccag
caacgactcctcctcgaaaccgcctgggaaaccatcgaacacgccggcatcaacccccac
accctccacggcacccccaccggagtcttcgccggaatcaacgctcaagaccacgccgcg
catatccgccaaagccgtgatgtggagaccatcgagggctacgccctgaccggcagttcg
ggaagtgtggcgtccggccgggtggcctacacgctcgggctcgaaggccccgcggtgtcg
gtggatacggcgtgttcgtcgtcgttggtggcgttgcattgggcggcgcaggcgttgcgt
gcgggtgagtgttcgatggcgcttgccgggggtgtgacggtgatgtcgtctccgggtacg
tttgtggagttctcacgtcagcggggtctggccgcggacgggcggtgcaaggcctattcg
gcggctgctgacggtaccggctgggccgagggtgtggggatgctgctggtggagcggctc
tccgacgcccgtcgcaacggtcaccgtgtcctggccgtggtgcgtggcagtgcggtcaac
caggacggtgcgagcaacggtctgaccgcgcccaacgggccctcccagcagcgtgtcatc
cgtcaggccctggccaatgcgggactgaccccggccgatgtcgacgcagtggagggccac
ggcaccgggaccactctgggggacccgatcgaggcccaggcactcctggccgcctacgga
caacaccgcccccaccaccgccccttgtggctgggatccctcaaatccaacatcgggcac
gcacaggccgccgcgggcgtgggcggagtcatcaagatggtgatggccctgcgcaacggg
ctgctgccacagaccctccacgtggacgagcccaccccccaggtcgactggtccacaggc
gcagtacaactcctgacacaaccggtgccctggcccgccgacccggccggccggccacgc
cacgccggcgtgtcatcattcggcgtcagcggcaccaacgcccacatcatcctcgaagaa
gcacccactccccaggacagcgataccgacgacgaaccgcctgccaacgcaccagccctg
ccccatcccctccctcttcccgtgccggtgtcggcgaggtctgaggccgggttgcgggcg
caggcacaggcgttgcgccagtacgtggcagcccgcccggacatgtcacctgccgacatt
ggtgcgggtctggcccgcggccgggccgtactggaacaccgcgccgtcatcctggccgcg
gaccgcgaggaactggcgcaggcactgacagccctggcagccggcgaaccccacccccac
atcaccacaggccacacccggggcggtgaccgcggcggcgtcgtcttcgtcttccccgga
cagggcggccagtgggccgggatgggcctgaccctgctcacctcctcacccgtgttcgcc
gaacacatcgacgcatgcgagaaagccctcaccccctgggtgccctggtccctgaccgac
atcctgcaccgcgaccccgacgaccccgcatggcaacaagccgacgtggtccagcccgtg
ctcttcagcatcatggtctccctcgccgccctgtggcgctcctacggcatcgaacccgac
gcggtcctcggccactcccagggagaaatcgccgccgcccacatctgcggcgcactcagc
ctgaaagacgccgccaaaaccgttgcactgcgcagccgcgcactggccgccgtacgaggc
cggggcgccatggcctcactgcccctgcccgcccaggacgtgcagcagctcatttccgaa
cggtgggaagggcagttgtgggtggcagccctcaacggcccccactccaccaccgtctcc
ggcgacaccaaggcggtggatgaggtgctggcgcactgcaccgacaccggcctacgggcc
aaacgcatccccgtcgactacgcctcccactgcccccacgtccaacccctccacgacgaa
ctcctgcacctgctgggagacatcaccccccagccgtccaccgtgccgttcttctccacc
gtggaaggcacctggctggacaccacaaccctggacgccgcctactggtaccgcaacctc
caccagcccgtccgcttcagccacgccatccagaccctgaccgacgacggacaccgcgcc
ttcatcgaaatcagcccccaccccaccctcgtccccgccatcgaagacaccaccgaaaac
accaccgaaaacatcaccgcgaccggcagcctccgccgcggcgacaacgacacccaccgc
ttcctcaccgccctcgcccacacccacaccaccggcatcggcacacccaccacctggcac
caccactacacccaaacccacccccaccccaacccccacacccacctcgacctgcccacc
taccccttccaacaccagcactactggctccaaccacccaccacaacaaccgacctcacc
accaccggcctcacccccacccaccaccccctcctcaccgccacactcaccctcgccgac
aacaacacacaactactcaccggccgcctctccctacgcacccacccctggctcaccgac
cacaccgtcgccggcatggtcctcctgccgggcaccgcgctcctcgaactcgccctccaa
gccggcgaacgggtggactgccctcgggtggaggaactgaccctgcacgcaccgttggtg
atcccgcacaccgaggacgtgacgttgcaggtcaccgttcgggcagccgatgagagtggc
catcgcgccctcgcgatccactcgtactccggcaccgcgtcgtcggcggaccgggagtgg
acccgtcacgccacgggcctcctcacacaccacgccgacaccgatcaccgtgccgacacg
cacacggacgcgtgccttggcgggagctggcccccgcccggcgcgcagcccatcgaactg
ggcgacgtctacggtcgtatggcggcggactcggacatcgcctacgggccggtcttccag
gggctgcacgccgcctggaggttcggcgacgatgtcctggccgaggtgcgtctgccggaa
gaggctctgcgcgatgctccggcggcggccttcggtgttcacccggccttgctcgacgcg
gccctgcacgccacggcgctcaccccccagaacggggacggctcgacggagaacgtcgcc
caggagagcatgcctgaccgcgcagcccaccaggcgcgactgccgttcagctggagcggc
gtgtccctgcacacggcgggcagttccgtgttgcgcgtacggctgtcgcgcagtccgcag
cacggtaatgccgtggccctcaccgcggccgacgaggacggtcggccggtggtgacgatc
gagtcgctcgcgctgcggccggtgtccaccgaggagctgcgcgcggccgcggatcgtacg
cccgagcacgagtcgctcttccgactggactgggtttccgtaccagtgcccgccaacgcc
ccttcgcccaccgcggaccggccctgggcggtcatcggcgcgggccttccccacctgccc
ggcctgacggagcacgagcacgtgaccgcgtatgacgagccggcggacctgcttctggct
ctggaccgcggtgctccgccgcccggtgtgctggtcgtaggtggtgtcgcccacaccgaa
gcccgggagtattccgccgaagcccccggggagcgcgggaccgaggcctgcgaggcccgg
ccggacgtcgtgcacgtgggcgtcgtgcacacggctgccgtgcacgcggctgccgcgcag
atgttggccaggctccaggcctggctgggcgacgagcgcctcgcagacagccggctgctc
gtcctgacgtgcggcgcggtcgcccgcgcctccggcgacgatgcgacggacctgcccggg
gccgccgtgtgggggctggtgcgttcggcgcagtccgagcacccggaccgcatcacgctg
ctggacttcgagcggggcacagaggcggagcccggtcagctggcgacggcgctgaactgc
ggggagcggcagcttgccgtccgccccggagggctgttcacgccacggctggtgcgcgcg
ccacgtgtcgccgacgccgtacccgccgtacccgccgtggccgtaccgtcagcgggtcac
gcagccgtaccggcagcgggtcccttccttccgggcggaacggtgctgatcaccggcgga
accggtgtcctgggccggctcgtggcccggcatctggtggaggcgcacggcgtacggcat
ctgttgctggcgggtcggcgcggaccggacgccgagggtgcgccggagttgcgggcggag
ctcggtgggctcggcgcgacggtggaggtcgtcgcctgcgacgcggcggaccggcagcag
ctggccgacctgctgacacggatccccgacgatcggccgctgaccggtgtcgtgcacagt
gcgggcatcctggacgacggcgtgatcacgtcgctgtcgccggagcggctcggggccgtc
ctccgggccaaggcggacgctgcgctgcttctcgacgagctgacgcgcggggcagagctg
tcggctttcgtcatgttctcctccgcgtcggcggtggtcggctcgcccgggcagggcaac
tacgccgccgccaacgccgtcctcgacttccttgctcatcgccgccgcgccgaggggctg
cccgccgtctctctcgcctggggcctgtgggaagagggcacagggatgacgggccacctc
gacgtcgacgaccatgcgcggatcagccgcgcgggaatgcggccgctgccgactgccgag
gctctggcgctgttcgacgcggccttggccgacggcgagccgttcctgatgccggctcgg
ctcgacctcacggccgtacggtctggtgccgcgtccgcaccggtgccgccgctgctgcaa
ggtctgcttcagctgcctcggtcccgctcggccgccgcggcccccggccatggggccccg
gcggcggacgaggcggcggcctggcgtgagcgtctggcccggcagagtgccggtgagcgc
aggcaggcgctgctgcgcctggtgcggtcgcatgtcgcggcggtgctcggccatagcggt
gccgacggaatcgacgcatcgcgggcgttccgcgagctggggttcgactcgctcacggcg
gtcgagctgcgcaaccgtctcacggccgcgacgggcctgcggctgcgggccacgctggcc
ttcgatttcccgaccccggcagcgctggccgagcacttgggcgagcgtctgcttcccgac
caggaggccacgggcgagcaagccggcgatcagctctccggcggcagcgaggaggacgta
cgcagcctcctgacgtccattccgatcggcaggctgcgggacgcggggctcctcgggccc
ctgctcacgctcgcggacacgggccgcggcgcctcgggcgccgccgcaggtccggaggac
gcgccgccctccggccaggacacaccggctcccgtctcgatcgacgagatggacatcgac
gacctgatggatctggcgcacgggcatggcaccgcacccgcccgtgagcccgccgacgca
gaggactcgtcgtcatcacgaaaccggacacaccacacacacgaaggtgagacagcgtga

DBGET integrated database retrieval system