KEGG   Serratia marcescens subsp. marcescens Db11: SMDB11_1445Help
Entry
SMDB11_1445       CDS       T03985                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
smac  Serratia marcescens subsp. marcescens Db11
Pathway
smac00480  Glutathione metabolism
smac00590  Arachidonic acid metabolism
smac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smac00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    SMDB11_1445
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SMDB11_1445
Enzymes [BR:smac01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SMDB11_1445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-ProteinID: CDG12019
Position
complement(1509502..1509987)
Genome map
AA seq 161 aa AA seqDB search
MIHSLLSIPCVTLQGEQKTLGDFPARAYLVVNTASKCGFTPQYRGLENLWQYYRERGLVV
LGFPCNQFGSQEPGSPLEIANFCSLNYGVSFPLFSKIDVNGPGAHPLFNELKRLAPGILG
SRRIKWNFTKFLLTADGQRITRFAPITKPERLFDRIETLLK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgattcactctctgttatccatcccctgcgtcacgctgcagggcgagcaaaaaacgctg
ggcgatttcccggcgcgcgcttacctagtggtcaacaccgccagcaagtgcggcttcacc
ccgcaataccgtgggctggaaaatttgtggcaatactatcgcgagcgcggcctggtggtg
ctcggcttcccctgcaatcagtttggttctcaggagccgggcagcccgctggagatcgcc
aacttttgcagcctcaactacggcgtcagtttcccgctgttcagcaagatagacgttaac
ggtcccggcgcgcacccgctgttcaatgagctgaaacgcctggcacccggcattctgggc
agccgccgcatcaagtggaatttcaccaaattcctgctcaccgccgacggccagcgtatc
acgcgctttgcgccgatcactaagcccgagcgtttgtttgaccgcatcgaaaccctgctg
aaataa

DBGET integrated database retrieval system