KEGG   Serratia marcescens subsp. marcescens Db11: SMDB11_2725Help
Entry
SMDB11_2725       CDS       T03985                                 

Gene name
hisQ
Definition
(GenBank) histidine ABC transporter, permease protein
  KO
K10016  histidine transport system permease protein
Organism
smac  Serratia marcescens subsp. marcescens Db11
Pathway
smac02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:smac00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SMDB11_2725 (hisQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smac02000]
    SMDB11_2725 (hisQ)
Transporters [BR:smac02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    SMDB11_2725 (hisQ)
   Histidine transporter
    SMDB11_2725 (hisQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: CDG13296
Position
complement(2883809..2884495)
Genome map
AA seq 228 aa AA seqDB search
MLQGYSQLIFEGALVTLELALSSVLLAVVIGLIGAGGKLSHNPFISGLFGAYTTLIRGVP
DLVLMLLIFYGLQIALNNITTLLGFSQIDIDPLGAGIITLGFIYGAYFTETFRGAYLAVP
KGQIEAATAYGFSGAQIFRRILFPAMMRFALPGIGNNWQVILKATALVSILGLNDVVKAT
QLAGKGTYQPFFFAIVAGVVYLIFTTVSNGVLLWLERRYSLGVKRAEL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaaggctattcccaactgattttcgagggggctctggtgacgttggagctggcc
ctcagttccgtgttgctggcggtggtgatcggcctgatcggcgccggtggcaaactgtct
cataacccctttatctccggtctgttcggcgcctataccacgctgatccgcggcgtgccc
gatctggtgctgatgctgctgatcttttacggcctgcaaatcgcgctgaacaacatcacc
acgctgctcggcttctcgcagatcgatatcgatccgctcggcgccggtatcattaccctc
ggctttatctacggtgcttacttcactgagaccttccgcggcgcctatctggcggtgccg
aaagggcagatcgaagcggcgacggcctacggcttcagcggcgcgcagatctttcggcgc
attctgttcccggcgatgatgcgtttcgctttgccgggcatcggcaacaactggcaggtg
atcctgaaggcgacggcgctggtgtcgatcctcggcctgaacgacgtggtgaaagccaca
cagctggcggggaaaggcacctatcagccgttcttcttcgccatcgtggccggcgtggtg
tacctgatcttcactaccgtttccaacggcgtgctgctgtggcttgaacggcgttactca
ctgggcgtcaagagggccgagctatga

DBGET integrated database retrieval system