KEGG   Serratia marcescens subsp. marcescens Db11: SMDB11_3477Help
Entry
SMDB11_3477       CDS       T03985                                 

Gene name
scrB
Definition
(GenBank) intracellular alpha-D-fructohydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
smac  Serratia marcescens subsp. marcescens Db11
Pathway
smac00052  Galactose metabolism
smac00500  Starch and sucrose metabolism
smac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SMDB11_3477 (scrB)
   00500 Starch and sucrose metabolism
    SMDB11_3477 (scrB)
Enzymes [BR:smac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     SMDB11_3477 (scrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: CDG14041
Position
3696150..3697559
Genome map
AA seq 469 aa AA seqDB search
MEELSLIKQAMRAVMNGLPLALRDPHRPAWHLAPSVGLLNDPNGFIQHNGIYHLFYQWNP
LGCDHRNKCWGHWQSTDLLRWAHQPIALAPGACYDSHGCYSGSAVVAEDKITLIYTGNVK
FPDGSRTAYQCLAQESDRGEYRKLGPVLPLPAGYSGHVRDPKVWRHQNAWYMVLGARDLQ
DRGKVLLLRSSDLRGWQPLGEIAGSGLHDLGEFGYMWECPDLFSLEDADVLICCPQGLAP
QPERYLNRYQAGYLLGKLDYLQPAFSHGEFRELDAGFEFYAPQTTLAEDGRRLLFGWMGV
PEQDEEAHPTRRYGWIHTMTCPRELSLRHGRLHQRPARELQQLRGERACWQGCADDAPAY
ALGAAELQLTPQGAFSAAFGEAMTLNWDGERLQLTRASLADGQPEHRYWRGPVTHLQLLF
DRSSVEIFINRGEAVMSARYFPASEPQLRLSGSAPLALEYWPLTPCMLE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggaggagctcagcttaatcaaacaggcaatgcgggcggtcatgaacggcctgccactc
gcgctgcgcgatccgcaccgcccggcctggcatctggcgcccagcgttggcctgctgaac
gatcccaacggcttcattcagcacaacggcatttatcatctgttctatcaatggaatccg
ctgggctgcgaccatcgcaacaagtgctggggacattggcagtcgaccgacttgctgcgt
tgggcgcatcagccgatcgccctggcgccgggcgcctgttacgacagccacggctgttac
tccggctcggcggtggtggcggaagacaaaatcacgctgatctacaccggcaacgtgaaa
ttccccgacggctcacgcaccgcttaccagtgcctggctcaggaaagcgatcggggcgag
taccgcaaactcgggccggtgctgccgctgccggcgggctacagcgggcacgtacgcgat
ccgaaagtgtggcgtcatcagaatgcgtggtacatggtgctcggcgcgcgggacttgcag
gatcgcggcaaggtgctgctgcttcgttccagcgatctgcgcggctggcaaccgctgggc
gagatcgccggttccggcctgcacgacctgggtgaattcggctacatgtgggagtgccca
gacctgttctcgctggaggacgccgacgtgttgatctgctgcccgcaggggctggcgccg
cagccggaacgctatctcaaccgttatcaggccggctatctgctcggcaagctggattac
ctgcagccggccttcagccacggcgaatttcgcgagctggacgccggcttcgagttctat
gcaccgcagacgacgctggcggaagatggccgccgcctgctgttcggctggatgggcgtg
cccgagcaagatgaagaagcccatccgacgcgccgttacggctggatccacaccatgacc
tgcccacgcgagctgtcgctgcggcatggccgcctccaccagcgcccggcgcgcgagctg
caacagctgcgcggcgagcgagcatgctggcaaggctgtgccgatgatgcccccgcctat
gcgctgggggctgcggagctgcagttgacgccgcagggcgcgttcagcgccgcgtttggc
gaggcaatgacgctgaactgggacggcgaaaggctgcagctgacgcgcgcttccctggcc
gacggccagccggagcaccgttactggcgcggcccggtcacgcatctgcagttgctgttc
gatcgttccagcgtggagatcttcatcaaccgcggcgaggcggtgatgagcgcgcgctac
ttcccggccagcgagccgcaactgcggctgtccggaagcgcgccgctggcgttggaatac
tggccgctgacgccatgcatgctagaatga

DBGET integrated database retrieval system