KEGG   Serratia marcescens subsp. marcescens Db11: SMDB11_4664Help
Entry
SMDB11_4664       CDS       T03985                                 

Definition
(GenBank) acetoacetate-CoA transferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
smac  Serratia marcescens subsp. marcescens Db11
Pathway
smac00071  Fatty acid degradation
smac00072  Synthesis and degradation of ketone bodies
smac00280  Valine, leucine and isoleucine degradation
smac00310  Lysine degradation
smac00362  Benzoate degradation
smac00380  Tryptophan metabolism
smac00620  Pyruvate metabolism
smac00630  Glyoxylate and dicarboxylate metabolism
smac00640  Propanoate metabolism
smac00650  Butanoate metabolism
smac00900  Terpenoid backbone biosynthesis
smac01100  Metabolic pathways
smac01110  Biosynthesis of secondary metabolites
smac01120  Microbial metabolism in diverse environments
smac01130  Biosynthesis of antibiotics
smac01200  Carbon metabolism
smac01212  Fatty acid metabolism
smac02020  Two-component system
Brite
KEGG Orthology (KO) [BR:smac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SMDB11_4664
   00630 Glyoxylate and dicarboxylate metabolism
    SMDB11_4664
   00640 Propanoate metabolism
    SMDB11_4664
   00650 Butanoate metabolism
    SMDB11_4664
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SMDB11_4664
   00072 Synthesis and degradation of ketone bodies
    SMDB11_4664
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SMDB11_4664
   00310 Lysine degradation
    SMDB11_4664
   00380 Tryptophan metabolism
    SMDB11_4664
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SMDB11_4664
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SMDB11_4664
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SMDB11_4664
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smac04147]
    SMDB11_4664
Enzymes [BR:smac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SMDB11_4664
Exosome [BR:smac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SMDB11_4664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CDG15222
Position
5012577..5013767
Genome map
AA seq 396 aa AA seqDB search
MNVQQREVVIVGATRTPVGSFHGALAPLTAVELGTAAVQGLLTQSGVAPQQIDEVILGQV
LTAGCGQNPARQTALNAGLPVTTPALTINKVCGSGLKAVHLAVQAIRSGDADAVIAGGQE
SMSQSPYLMAGARAGLRLGHAQMVDSVIHDGLWDVFNDYHMGITAENLAEKYAISREEQD
RFALRSQQKAQAAQQAGRFAQEITPVTVPQPKGEALRVEHDEQPRDTSLEALARLRPAFR
KEGTVTAGNASSLNDGAAVVLLMSAEKAAALRLPVLARIAGYASSGVDPAIMGIGPAPAA
RRCLEKAGWRLEDVDLIEANEAFAAQALAVGKELGWEAERVNVNGGAIALGHPIGASGCR
ILVSLLYEMQRREVNKGLAMLCIGGGQGVALAVERP
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgtgcaacaacgtgaagtggtgatcgtgggggcgacgcgcacgccggtcggcagt
tttcacggcgcgctggcgccgctgacggcggtggaactgggcacggcggcggtgcagggg
ctgctgacgcaaagcggcgtggcgccgcagcagatcgatgaagtgatcctcggccaggta
ctgaccgccggctgcggacagaatccggcgcgtcagaccgcgctgaacgccgggctgccc
gtgacgaccccggcgctgaccatcaacaaggtgtgcggctccggtttgaaggcggtacat
ctggcggtgcaggcgatccgcagcggtgacgccgacgcggtgatcgccggcggccaggaa
agcatgagccagtcgccttacctgatggccggtgcgcgcgccggcctgcgcctcggtcac
gcgcagatggtggacagcgtgatccacgatggcctgtgggacgtgttcaacgactaccac
atgggcatcaccgccgagaacctggcggagaaatacgccatcagcagggaagaacaagac
aggttcgccctgcgctcgcagcagaaggcgcaggcggcgcagcaggccgggcgtttcgcg
caggagatcacgccggtgacggtgccgcagccgaagggtgaggcgctgcgggtcgagcac
gacgaacagccgcgcgacaccagcctggaggcgctggcgcggctgcgcccggcgtttcgc
aaagagggcacggtgaccgccggcaacgcctcgtcgctcaacgacggcgccgccgtggtg
ctgctgatgagcgcggaaaaagccgcagcgctgcgtttgccggtgctggcgcgcatcgcc
ggttacgcctcgtcgggcgtcgatccggcgatcatgggcatcggcccggcgccggccgca
cgccgctgcctggagaaagccggctggcggctggaggacgtcgatctgatcgaagccaac
gaagccttcgccgcgcaggcgctggcggtgggcaaagaactgggctgggaggcggagcgg
gtcaacgtcaacggtggggcgatcgcgctggggcatccgatcggcgcgtccggctgccgc
attttggtgtcgctgctgtacgaaatgcagcgccgcgaggtgaacaaggggctggcgatg
ctgtgcatcggcggcgggcagggcgtggcgctggcggtagagcgcccgtaa

DBGET integrated database retrieval system