KEGG   Serratia marcescens FGI94: D781_0894Help
Entry
D781_0894         CDS       T02433                                 

Definition
(GenBank) hypothetical protein, contains double-stranded beta-helix domain
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
smaf  Serratia marcescens FGI94
Pathway
smaf00270  Cysteine and methionine metabolism
smaf01100  Metabolic pathways
Module
smaf_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    D781_0894
Enzymes [BR:smaf01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     D781_0894
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     D781_0894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2
Motif
Other DBs
NCBI-ProteinID: AGB81227
UniProt: L0MD64
Position
953204..953746
Genome map
AA seq 180 aa AA seqDB search
MSALTIYSDEQPQQPLWQSRDGEQIRRQLEQVGVRFERWQADRELGDDPQPEAVIAAYQH
AIDRLVAEKGYQSWDVIAMRPDHPQREALRQKFLSEHTHGEDEVRFFVEGAGLFCLHLNQ
RVYQILCEKNDLISVPAHTPHWFDMGAAPHFTAIRVFDNPEGWIAQFTGDPIAGAFPRLD
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctttgaccatttatagcgatgaacagccgcagcagccgctgtggcagagccgc
gacggtgaacagatacgccggcagctggagcaggtcggcgtgcgctttgaacgctggcag
gccgaccgtgagttaggggatgatccgcagccggaggcggtgatcgccgcctatcagcat
gccatcgatcggctggtggcggaaaagggctaccaaagctgggatgtgatcgccatgcgt
ccggatcatccgcagcgcgaggcgctgcggcagaagtttttgtcggagcatacccacggc
gaagatgaggtccgcttctttgtggaaggtgccgggctgttttgcctgcatctgaaccag
cgggtataccagatcctgtgtgagaaaaacgatctgatctcggtaccggcccacacgccg
cactggtttgatatgggagccgcgccgcattttaccgccatccgcgtgtttgataacccg
gaagggtggatcgcgcagttcaccggcgatccgatcgccggcgcatttccgcgtctggat
tag

DBGET integrated database retrieval system