KEGG   Serratia marcescens FGI94: D781_1186Help
Entry
D781_1186         CDS       T02433                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
smaf  Serratia marcescens FGI94
Pathway
smaf00020  Citrate cycle (TCA cycle)
smaf00190  Oxidative phosphorylation
smaf00650  Butanoate metabolism
smaf01100  Metabolic pathways
smaf01110  Biosynthesis of secondary metabolites
smaf01120  Microbial metabolism in diverse environments
smaf01130  Biosynthesis of antibiotics
smaf01200  Carbon metabolism
Module
smaf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
smaf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
smaf_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    D781_1186
   00650 Butanoate metabolism
    D781_1186
  Energy metabolism
   00190 Oxidative phosphorylation
    D781_1186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AGB81505
UniProt: L0MFG8
Position
1243717..1244064
Genome map
AA seq 115 aa AA seqDB search
MVNNASALGRSGVHDWLLLRASAIVITLYVLYILGFVVTAPDITYEIWRGFFATSITKVF
TVLTLLSILAHAWIGLWQVLTDYIKPLALRLVLQLAVVVLLLVYLLYGTIVVWGA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacaatgcttccgcattagggcgcagcggcgtacacgactggttgttactgcgt
gcttccgctatcgtcatcaccctgtatgtcctctatatcctgggctttgtcgtcacggct
ccggacatcacctatgaaatctggcgcggcttcttcgccacctcaattacgaaagtcttc
accgtgttgaccttgctgtcgattctggcgcacgcctggatcggtctgtggcaggtgctg
acggattatattaagccgttggcgttacgcctggtgctgcaactggcggtggtcgtcctg
ttgctggtctatttactgtacggaacaatcgtagtgtggggtgcgtaa

DBGET integrated database retrieval system