KEGG   Serratia marcescens FGI94: D781_1191Help
Entry
D781_1191         CDS       T02433                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
smaf  Serratia marcescens FGI94
Pathway
smaf00020  Citrate cycle (TCA cycle)
smaf00640  Propanoate metabolism
smaf00660  C5-Branched dibasic acid metabolism
smaf01100  Metabolic pathways
smaf01110  Biosynthesis of secondary metabolites
smaf01120  Microbial metabolism in diverse environments
smaf01130  Biosynthesis of antibiotics
smaf01200  Carbon metabolism
Module
smaf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
smaf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    D781_1191
   00640 Propanoate metabolism
    D781_1191
   00660 C5-Branched dibasic acid metabolism
    D781_1191
Enzymes [BR:smaf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     D781_1191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AGB81510
UniProt: L0MFH3
Position
1251021..1252187
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGMPAPTGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KVVNSKEDIRAFAEAWLGKRLVTYQTDAQGQPVHQILVEAATDIDKELYLGAVVDRGTRR
IVFMASTEGGVEIEKVAEETPELIHKTTIDPLAGPQPYQGRELAFKLGLSGKQVSQFAKI
FMGLATLFLERDLAMVEINPLVITKQGDLVCLDGKLGADGNALFRQPELREMQDLSQEDE
RESRAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDKVKAVLVNIFGGIVRCDLIADGIIGAVAEVGVSVPVVVRLEGNNADLGAKK
LADSGLNIIAATSLTDAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgaatatcaggcaaaacagttgtttgctcggtatggtatgccggcacca
accggttacgcctgtactacaccgcgtgaagcagaagaagccgcgtccaaaatcggcgcc
ggtccgtgggtagttaaatgtcaggttcatgctggcggccgcggcaaagccggcggcgtt
aaagtggtaaacagcaaagaagatatccgcgctttcgctgaagcctggttgggcaagcgt
ctggtgacctaccaaactgacgcgcagggccagccggttcaccagatcctggttgaagcc
gctaccgatatcgataaagagctgtatctgggcgcggtggttgaccgcggcacccgtcgc
atcgtgttcatggcgtctaccgaaggcggcgtggaaatcgagaaagtggcggaagaaacg
ccggaactgatccacaaaaccaccattgatccgctggcgggcccgcagccttaccagggc
cgtgagctggcgttcaaactgggcctgagcggcaagcaggtcagccagttcgccaaaatc
ttcatgggtctggcgacgctgttcctggaacgcgacctggcgatggttgagatcaacccg
ctggtaatcaccaagcagggtgacctggtgtgtctggacggcaaactgggtgccgacggc
aacgccctgttccgtcagccggaactgcgtgaaatgcaggatctgtctcaggaagatgag
cgcgaatcacgtgcggcgcagtgggaactgaactacgtcgcgctggatggcaacatcggc
tgcatggttaacggtgcaggcctggcgatgggcaccatggacattgtcaaactgcacggc
ggcgaaccggccaacttcctggacgtgggcggcggcgcaaccaaagagcgcgtgaccgaa
gcgtttaaaatcatcctgtccgacgacaaggtgaaagcggttctggtgaacattttcggt
ggtatcgtgcgttgcgacctgatcgccgacggtatcattggcgcagtggccgaagtgggc
gttagcgtcccggtggttgtgcgtttggaaggtaacaatgccgatctgggcgccaagaaa
ctggcggacagcggtctgaatatcattgctgcgaccagcctgactgatgcggctcagcaa
gttgttgcggcagtggagggtaaataa

DBGET integrated database retrieval system