KEGG   Serratia sp. FGI94: D781_1480Help
Entry
D781_1480         CDS       T02433                                 

Definition
(GenBank) protein containing C-terminal region/beta chain of methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
smaf  Serratia sp. FGI94
Pathway
smaf00450  Selenocompound metabolism
smaf00970  Aminoacyl-tRNA biosynthesis
smaf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smaf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    D781_1480
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    D781_1480
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:smaf01007]
    D781_1480
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:smaf03016]
    D781_1480
Enzymes [BR:smaf01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     D781_1480
Amino acid related enzymes [BR:smaf01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   D781_1480
Transfer RNA biogenesis [BR:smaf03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    D781_1480
 Prokaryotic type
   Other AARSs
    D781_1480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AGB81787
UniProt: L0MES2
Position
complement(1541527..1543560)
Genome map
AA seq 677 aa AA seqDB search
MAQVAKKLLVTCALPYANGSIHLGHMLEHIQADIWVRYQRMRGNEVHFICADDAHGTPIM
LKAQQLGVSPEDMIAEMSQEHQQDFAGFNISYDNYHSTHSEENRELSSLIYRRLKENGFI
KNRTISQLYDPEKGMFLPDRFVKGTCPKCKSPDQYGDNCEVCGATYSPTELIDPKSAVSG
ATPVMRDSEHFFFDLPSFSEMLQAWTRSGALQEQVANKMQEWFDSGLHQWDISRDAPYFG
FEIPDAPGKYFYVWLDAPIGYMGSFKNLCDKRGDLDFDEFWRKDSTTELYHFIGKDIVYF
HSLFWPAMLEGSNFRKPTNLFVHGYVTVNGAKMSKSRGTFIKAGTYLKHLDADCLRYYYA
AKLSSRIDDIDLNLEDFVQRVNADIVNKVVNLASRNAGFIKKRFDGRLADQLADPALYQT
FTDAADSIADAYASREFSRAVREIMALADLANRYVDEQAPWVVAKEEGRDADLQAICSMG
INLFRVLMTYLKPVLPSLAQRAEEFLNGELSWDSIQQPLLGHQVNAFKALFNRIDLDKVN
DMVNASKEDLIASQAPAVTGPLADDPIQDTITFDDFAKVDMRIALIKSADFVEGSDKLLK
LQLDLGGENRQIFSGIRSAYPDPKLLEGRLTIMVANLAPRKMRFGISEGMVMAAGPGGKE
IFLLSPDSGAQPGMQVK
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atggctcaagtcgcgaaaaaattattggtgacgtgcgcgctaccgtacgcaaatggttcc
atccatctcggccacatgctcgagcacatccaggcggatatctgggttcgttaccaacga
atgcgcggcaacgaagttcatttcatctgcgcggacgacgcgcacggcacgccaatcatg
ctgaaagcacagcagttgggcgtctcgccggaagacatgattgccgaaatgagccaggag
catcagcaggatttcgccggtttcaacatcagctacgacaactaccactcgacgcacagc
gaagaaaaccgcgagctgtccagcctgatttaccgtcgcctgaaagagaacggctttatc
aagaaccggacgatttctcagctgtacgatccggagaaaggcatgttcctgccggaccgc
tttgtgaaaggcacctgtccgaagtgtaaatcaccggatcagtacggtgataactgcgaa
gtgtgcggcgccacctacagcccgaccgagcttatcgatccgaagtccgcggtatccggc
gccacgccggtcatgcgcgactccgagcacttcttcttcgacctgccgtccttcagcgaa
atgctgcaggcgtggacgcgctccggcgcgctgcaggagcaggtggcgaacaaaatgcag
gagtggttcgactccggcctgcaccagtgggacatctcccgcgacgcgccctatttcggc
ttcgaaattcccgacgcgccgggcaaatacttctacgtctggctggacgcgccgatcggc
tacatgggctccttcaagaacctgtgcgacaagcgtggcgacctggacttcgacgagttc
tggcgcaaggactccaccaccgagctgtatcactttatcggtaaagacatcgtctatttc
cacagcctgttctggccggcgatgctggaaggcagcaacttccgcaagccgaccaacctg
ttcgttcacggctatgtgacggttaacggcgccaagatgtccaaatcgcgcggcaccttt
atcaaggccggcacctacctgaagcatctggacgccgactgcctgcgctattactacgcc
gccaagctgtcgtcgcgcatcgacgacatcgacctcaacctggaagatttcgtgcagcgc
gtcaacgccgatatcgtcaacaaggtggtcaacctggcgtcgcgcaacgccggctttatc
aagaaacgtttcgacggccgtctggcggaccagctggcggatccggcgctgtatcagacc
tttaccgatgcggccgacagcatcgccgacgcctacgccagccgcgaattcagccgcgcc
gtgcgtgaaatcatggcgctggcggatctggccaaccgctatgtggacgagcaggcgccg
tgggtggtggcgaaggaagagggtcgcgacgccgatctgcaggctatctgctcaatgggc
atcaacctgttccgcgtgctgatgacctacctgaagccggtactgccgtcgctggcgcag
cgcgccgaagagttcctgaacggcgaactgagctgggacagcattcagcagccgctgttg
ggtcatcaggtcaacgcctttaaggcgctgttcaaccgcatcgatctcgacaaggtcaac
gacatggtcaacgcgtccaaagaagatctgatcgccagccaggcgccggcagtcaccggt
ccgctggcggacgatccgatccaggacaccatcacctttgacgacttcgccaaagtggat
atgcgcattgcgctgatcaaaagcgccgacttcgttgaaggctcggacaaactgctgaag
ctgcagctggatctgggcggcgaaaaccgtcagatcttctccggcatccgttctgcttat
ccggatccgaagctgctggaagggcgtctgacgatcatggtcgccaacctggcgccgcgc
aaaatgcgcttcggcatctccgaaggcatggtgatggccgccggcccgggcgggaaggaa
atcttcctgctgagcccggacagtggcgcacagccgggcatgcaggtgaagtaa

DBGET integrated database retrieval system