KEGG   Serratia sp. FGI94: D781_1676
Entry
D781_1676         CDS       T02433                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
smaf  Serratia sp. FGI94
Brite
KEGG Orthology (KO) [BR:smaf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smaf02044]
    D781_1676
Secretion system [BR:smaf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   D781_1676
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AGB81974
UniProt: L0MDI7
Position
1764726..1765223
AA seq 165 aa
MSNSYQSEIPKARVNIKLDLHTGGAQKKVELPLKLMVVGDYSNGSEQRPLSEREKINVNK
NNFDSVLAEFSPSVNLAVENTLAGDGSEENVSLTFREMNDFTPEQVARQIPQLKAMLAMR
NLLRDLKANLLDNQTFRKELEKILLDPALSAELRDELSALAPAQP
NT seq 498 nt   +upstreamnt  +downstreamnt
atgtctaactcataccagtccgagatccccaaggcccgcgtcaatatcaagctggacctg
cataccggcggcgcccagaaaaaagtcgaactgcccctcaagctgatggtggtgggggat
tacagcaacggcagtgaacaacgcccgctgtccgagcgcgagaagatcaacgttaacaaa
aacaattttgacagcgtactggccgaattctctccgtcggtcaacctggcggtggaaaac
actctggccggcgacggcagcgaggaaaacgtcagcctgacgttccgcgagatgaacgat
ttcaccccggaacaggttgcccgccagatcccgcagctgaaagccatgctggccatgcgc
aacctgctgcgcgacctgaaggccaacctgctggacaaccagacgttccgtaaagagctg
gagaaaattctgctggatcccgccctgagcgctgaactgcgcgatgaactgtccgccctg
gcgccggcgcagccgtaa

DBGET integrated database retrieval system