KEGG   Serratia sp. FGI94: D781_1677Help
Entry
D781_1677         CDS       T02433                                 

Definition
(GenBank) type VI secretion protein, EvpB/VC_A0108 family
  KO
K11900  type VI secretion system protein ImpC
Organism
smaf  Serratia sp. FGI94
Brite
KEGG Orthology (KO) [BR:smaf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smaf02044]
    D781_1677
Secretion system [BR:smaf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   D781_1677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB APG6
Motif
Other DBs
NCBI-ProteinID: AGB81975
UniProt: L0MGU8
Position
1765257..1766804
Genome map
AA seq 515 aa AA seqDB search
MLMSVKNENAAGGESVVLECPQAGGVYASLFEKINLNPVASLSALDSWQDNQTMSDATAD
ERVTAAMQIFLERLKQSGDKVEKLDKTLLDHHIAELDHQISRQLDAVMHHEDFQRVESLW
RGMKSLVDKTDFRQNVKIELLDLSKDDLRQDFEDAPEIVQSGLYLQTYVAEYDTPGCEPI
GALISAYEFDASAQDIALLRNISKVSAAAHMPFIGSAGPKFFLKDNMEDVAAIKDIGNYF
DRAEYIKWKAFRETDDARYIGLVMPRVLGRLPYGPDTVPVRSFNYVEEVKGPDHDKYLWT
NASFAFAANMVRSFINNGWCVQIRGPQAGGAVQGLPIHLYDLGTGNQVKIPSEVMIPETR
EFEFANLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIA
HYLKLIQRENIGTTKDRRLLELELNTWVRSLVTEMTDPGDELQASHPLRDARVAVEDIED
NPGFFRVKLYAVPHFQVEGMDVNLSLVSQMPKAKA
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgctgatgtctgtaaaaaatgagaatgccgccggcggcgagagcgtggtgctggagtgt
ccgcaggcgggcggtgtgtatgcttccctgtttgaaaaaatcaacctgaacccggtggcg
tcgctgagcgcgctggacagctggcaggataaccagacgatgtccgacgccacggcggac
gaacgcgtcaccgccgcgatgcagatcttcctggagcgtctgaagcagtcgggcgacaag
gtggaaaaactcgacaagaccctgctggatcaccacattgccgaactggaccatcagatc
agccgccagttggacgcggtgatgcaccacgaggatttccaacgcgttgaatccctgtgg
cgcggcatgaagtcgctggtggacaaaaccgatttccgtcagaacgtcaaaatcgagctg
ctggatctgtcgaaggacgacctgcggcaggattttgaggacgcgccggaaatcgtgcaa
agcggcctctacctgcagacctacgttgccgaatacgacaccccgggctgcgagccgatc
ggcgcgctgatctccgcctatgagttcgacgcctccgcgcaggatatcgcgctgctgcgc
aatatttccaaggtgtccgccgcggcgcacatgccgtttatcggctccgccgggccgaag
ttcttcctgaaagacaacatggaagacgtcgccgccattaaggatatcggcaattacttt
gaccgcgccgaatacattaaatggaaagccttccgcgaaactgatgacgcgcgctatatc
ggcctggtgatgccgcgcgtgctgggccgcttgccgtatggcccggacaccgtgccggtg
cgcagctttaactatgtggaagaggtcaaaggcccggaccacgataaatacctgtggacc
aacgcctccttcgcgttcgccgccaatatggtgcgcagctttatcaacaacggctggtgc
gtgcagatccgcggcccgcaggcgggcggcgcggtgcagggcctgccgatccatctctac
gatctcggcaccggcaaccaggtgaaaatcccgtcggaagtgatgatcccggaaacccgt
gagtttgagttcgccaacctgggctttatcccgctgtcgtactacaaaaaccgcgactat
gcgtgcttcttctccgccaactccgcccagaagccggcgctgtacgacaccgcggacgca
accgccaacagccgcatcaacgcgcgtctgccgtacatcttcctgctgtcgcgcatcgcg
cactacctgaagctgatccagcgtgaaaacatcggcaccaccaaggatcgccgcctgctg
gagctggagctgaacacctgggtgcgcagcctggtgaccgaaatgaccgatccgggcgac
gagctgcaggcctcgcacccgctgcgcgacgccagggtggcggtggaagatatcgaagac
aacccgggcttcttccgcgtgaagttgtatgcggtgccgcacttccaggtggaagggatg
gacgtcaacctgtcgctggtatcccagatgccgaaggcgaaagcataa

DBGET integrated database retrieval system