KEGG   Serratia sp. FGI94: D781_1691
Entry
D781_1691         CDS       T02433                                 

Definition
(GenBank) hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
smaf  Serratia sp. FGI94
Pathway
smaf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:smaf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    D781_1691
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smaf02044]
    D781_1691
Secretion system [BR:smaf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   D781_1691
SSDB
Motif
Pfam: IcmF-related IcmF_C
Other DBs
NCBI-ProteinID: AGB81989
UniProt: L0MDJ7
Position
1782713..1786132
AA seq 1139 aa
MDNVNKPAVISVAATAAVCIAVTTLLVLLGGLAWWLWGSERATQWDALRPLIVAGFIVWG
TALSLLMLGFMAFRLLIKDKVSPSTSRKRQPTTASGRETAYVALKKHLRTRYGPFWRRKV
HLLLVVGDAAAIEQLVPGLQAQRWLEGSRTVLIYGGGLASDPDREQLSALRRLRRGRPLD
GVVRVLNTDQSLTPQLSDSDLRGLEKIGDLLRYQPAVWLWQLCSSDWPQAGRQPQAVGIT
LPARGSADEAAARLGELLPQLRAQGLAQVAENRAFDFLLRLAQRLEQGDGARWKNALTPW
LYGAQRRVPLRGLMFSLPGAADAQVQGSKESAAAARHPHAVTFSDAWQGIFDDRVRGRRV
GMAWEQTLALAVMAGIGLWAVGMTISFVANRQQIVAVADKAQALVARPAVTDAQLGALHA
LRNDAGRLQQHSRAGAPWYQRFGLDHNPQLLAAMLPWYGVANNRLIRDPAGEALRQTLTQ
LVNSPPNSPQRIALAKPGYDRLKAWLMMARPDKVDAAFYAQTLQAVQPAPRGISPGLWQS
LAPDLWAFYIAELAQQPGWKITPDAALVSQSRQVLLQQIGRRNAESTLYENMLKSVRRNF
ADLRLEDMTGGTDARRLFDSREVVPGMFTRQAWEGGIQQAIEKAANARRDEIDWVLSDSS
QGVAADISPEALKARLTQRYFTDFAGSWLGFLNGLHWQPANNIADVTDQLTLMSDVRQSP
LIALMNTLAWQGQTGQKGKALSDSLLKSAKELLHSDSRPAIDQSAAGPVGPLDEAFGPLL
TLMGKNPAGQVMAANSTLSLQIYLTRITRVRLRLQQVASASDPQEKMQTLAQTVFQGKSV
DLTDTQQYGSLMAASLGEEWSGFGQTMFVQPLTQAWETVLQPSAASLNGKWRRAVVSNWQ
SAFDGRYPFAASKSEASLPMLAEFIRKDTGRIERFLAQELGGVLHKEGSRWVVDKTNSQG
LNVNPAFLKAVNQLSQLSDILFTDGSQGIGFELQARPTPQVVETTLTIDGQKLRYFNQMA
EWQTFRWPGETFKPGTMLTWSATNAGARLFGDYGGTWGFIRWLEQGKRRQLDRSQWMMSF
SAPGGRTLQWVLRSQLGIGPLALLALRGFTLPEQIFSVDATAATQALSSSDDPVMNGIE
NT seq 3420 nt   +upstreamnt  +downstreamnt
atggacaacgtcaataaacctgctgtcatctctgtggcagccacggccgccgtctgtatt
gctgtgaccacgctgctggtcctgttaggcgggctggcatggtggctgtgggggagcgaa
cgtgctacgcaatgggatgcgttgcgtccgctgatcgttgccggttttatcgtctgggga
acggcgctcagcctgctgatgctgggttttatggctttccgcttgctgattaaggacaag
gttagcccgtcgacatcccgtaagcgtcaaccgacaacggcaagtgggcgagaaaccgca
tatgtcgcgctgaaaaaacatctccgtacccgctacggccctttctggcggcgcaaagtg
catctgctgctggttgtcggcgatgctgccgctattgaacaactggttcccggcctgcag
gctcagcgctggctcgagggcagccgcaccgtgctgatttacggcggtggcctggcatcg
gatcccgaccgcgaacaactctccgccctgcgcaggctgcgccgcggccgcccgctggac
ggggttgtccgcgtgctgaatacagaccagtcgctgacgccgcagctgagtgatagcgat
ctgcgggggctggaaaaaatcggcgacctgttgcgttaccagccggcggtctggctgtgg
cagttgtgcagcagcgattggccgcaggcgggtcggcagccccaggcggtaggtattacg
ctgccggcgcggggcagcgcggacgaggcggcggcccggctcggcgagttgctgccgcag
ctgcgtgcacaggggcttgctcaggtggcggaaaaccgggcctttgattttctgctgcgt
ctggcgcagcggttggagcagggcgacggcgcgcgctggaaaaatgcgctgacgccgtgg
ctgtacggcgcccagcggcgcgtgccgctgcgcggcctgatgttcagcctgccgggtgcg
gctgacgcacaggttcaagggagcaaagagagtgccgcagcggcgaggcatccgcatgcc
gttaccttctcggacgcctggcagggcatctttgatgaccgcgtccgcggccgccgggtc
ggcatggcctgggaacagacgctggcgctggcggtgatggccggcatcgggctgtgggcc
gtggggatgacgatctccttcgtcgccaaccgccagcaaattgtcgcggtggcggacaag
gcgcaggcgctggtcgcccggccggcggtgacggatgcgcagctcggcgctctgcatgcg
ctgcgcaacgacgccggccgtctgcagcagcatagccgcgcaggcgcgccctggtatcag
cgtttcgggctggatcacaatccgcagctgctggccgcgatgctgccctggtacggcgtg
gcgaataaccgtttgatccgcgatccggccggcgaggcgctgcggcaaacgctgacccaa
ctggtgaattcgccgcccaacagcccacagcgcatcgcgctggccaaacccggttacgat
cggctgaaagcctggctgatgatggcgcgcccggataaggttgacgccgctttctatgcg
caaaccctgcaggcggtgcagcctgcgccccggggcatctcccccgggctgtggcagagc
ctggcgccggacctgtgggcgttctatatcgccgagctggctcagcagcccggctggaaa
attaccccggatgcggcgctggtcagccagagccgtcaggtgctgttgcagcagatcggg
cgtcgcaacgctgaaagtacgctgtatgagaatatgctcaaatcggtgcgccgtaacttt
gccgatctgcggctggaagatatgaccggcggcaccgatgcccggcggctgttcgacagc
cgggaggtggtgccgggaatgttcacccgtcaggcctgggaagggggcattcagcaggcg
atagagaaggcggccaacgcccggcgcgatgagatcgactgggtgctgagcgacagcagc
cagggcgtcgcggcggatatctcgccggaagcgctgaaggcccgcctgacgcagcgttac
ttcacggattttgccggcagctggctcggtttcctcaacggtctgcactggcagccggcc
aacaacattgccgatgtgaccgaccagctgacgctgatgagcgacgtacggcagtcgccg
ctgattgccctgatgaatacgctggcctggcaggggcaaaccgggcagaagggcaaggcg
ctgtccgattcgctgctcaaatcggcgaaagagctgctccacagcgacagccggccggcc
atcgatcagagcgcggccgggccggttggcccgctggatgaggctttcggcccgctgctg
accctgatgggcaaaaatccggccggtcaggtgatggcggccaacagtaccctcagcctg
caaatctacctgacccgcattacccgcgtacggttacggctgcagcaggtggccagcgct
tcagacccgcaggaaaaaatgcagacgctggcgcagacggtatttcagggcaaaagcgtc
gatctgaccgacacccagcagtacggcagcctgatggccgccagcctcggcgaggagtgg
agcggctttgggcagacgatgttcgtccagccgctgacgcaagcctgggaaaccgtgctg
cagccgtccgccgccagcctgaacggcaagtggcgcagggcggtggtcagcaactggcag
agcgccttcgacggccgctatccgttcgccgccagtaaaagtgaggcttcgctgccgatg
ctggcggagtttatccgcaaggataccggccgcattgaacgttttctggcgcaggagctg
ggcggcgtgctgcacaaagagggcagccggtgggtggtggataaaaccaacagccagggg
ctgaacgttaacccggcgtttctgaaggccgtcaaccagctcagccagctgtcggacatt
ctgtttaccgacggcagccaggggatcggctttgaactgcaggcgcgtccgacgcctcag
gtggtggaaaccacgctgaccattgacggccagaaactgcgttacttcaaccagatggcg
gaatggcagactttccgctggccgggagagacctttaagccgggcaccatgctgacctgg
agcgccaccaacgccggcgcccgattgtttggcgactacggcggcacctggggctttatc
cgctggctggagcagggcaagcggcgccagctcgatcgcagccagtggatgatgagcttc
agcgcgccgggtggccgcacgctgcagtgggtgctgcgttcacagctgggcattggcccg
ctggcgctgctggcgttacgcggtttcacgcttccagagcagatattcagtgtggatgcc
acagcggcaacacaagcgctgagttctagcgatgatccggttatgaatggaattgaataa

DBGET integrated database retrieval system