KEGG   Serratia sp. FGI94: D781_1908Help
Entry
D781_1908         CDS       T02433                                 

Definition
(GenBank) beta-fructofuranosidase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
smaf  Serratia sp. FGI94
Pathway
smaf00052  Galactose metabolism
smaf00500  Starch and sucrose metabolism
smaf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smaf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    D781_1908
   00500 Starch and sucrose metabolism
    D781_1908
Enzymes [BR:smaf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     D781_1908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AGB82194
UniProt: L0ME28
Position
complement(2009080..2010522)
Genome map
AA seq 480 aa AA seqDB search
MKELLAQADHAVEKLRAARQDDLYPRFHLAAQAGWINDPNGLICIDGVYHAFYQHHPFDE
HWGPMHWGHATSRDLVHWQHQPIALAPGDADDRDGCFSGCAVDDYGVLTLLYTGHVWLGE
PGDDSQLREVQCLATSEDGIHFTKHGAVLTPPEGIMHFRDPKVWQQDGQWWMVIGAKEDD
LGQVRLYRSDDLRNWRFERVLAAAEHARQGYMWECPDFFPLGERQLLVFSPQGLAAQGYR
YRNRFQSGYLLGNWQPDGAFTVTQPFSELDAGHDFYAPQTFTAADGRRLLFGWMDMWESP
MPSKAHGWAGALTLPRELSLGADGQVRMQPARELTALRGAVRQFDAVRCRNQRLPLGDEL
HELQLTLDTADSDAERYGISLGGAARLYVDNQAHRLVLERFSDDPALCGCRSVPLPAGVS
LQLRLFIDRSSLEVFVNDGEACLTSRIYPLDGDRRLNLFAEGGAAYFSAIAGWTLDSIWR
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaacttttagcccaggccgaccacgccgtagaaaagctgcgcgccgcgcgtcag
gacgacctgtacccgcgtttccacctggccgcgcaggccggctggattaacgaccccaac
ggactgatttgcatcgacggggtgtaccacgcgttttatcagcaccaccccttcgatgag
cactgggggccgatgcactgggggcacgccaccagccgcgatctggtgcactggcagcat
cagccgatcgcgctggcgcccggcgacgccgacgaccgcgacggctgtttctccggctgc
gcggtcgatgattacggcgtgctgacgctgctgtataccggccacgtctggctcggcgag
ccgggcgacgactcgcagctgcgcgaggtgcagtgtctggccaccagcgaggacggcatc
catttcaccaagcatggtgcggtactgacgccgccggaaggcattatgcacttccgcgat
ccgaaagtgtggcaacaggacgggcagtggtggatggtcatcggcgccaaagaggacgat
ctgggtcaggtgcggctgtaccgttccgacgatctgcgtaactggcgctttgaacgggtg
ctggccgccgccgagcacgcccggcagggctatatgtgggagtgcccggacttcttcccg
ctgggggaacgccaactgctggtcttttcgccgcaggggctggcggcgcagggctaccgc
tatcgcaaccgcttccagagcggctacctgctcggcaactggcagccggacggcgcattc
acggtcacccagccgtttagcgagctggacgccgggcatgatttttacgcgccgcagacc
ttcaccgccgccgacggccgtcgcctgctgttcggctggatggatatgtgggagtcgccg
atgcccagcaaggcgcacggctgggccggtgcgctgacgctgccgcgtgaactgtcgctc
ggcgccgacggccaggtgcgtatgcagccggcgcgcgaactgacggcgctgcgcggcgcc
gtacgccagtttgacgccgtgcgctgccgcaaccagcggctgccgctgggggatgagctg
cacgaactgcagctgacgctggatacggccgacagcgacgccgaacgctacggcatcagc
ctgggcggcgcggcacggctgtatgtggataatcaggcgcaccggctggtgcttgagcgg
ttcagcgacgatccggcgctgtgcggttgccgcagcgtgccgctgcccgccggcgtatct
ttgcagctgcggctgtttatcgatcgttcttcactggaggtgttcgtcaacgacggcgag
gcctgcctgaccagccgcatctacccgctggacggcgaccgccggctgaacctgtttgcc
gaaggcggcgcggcgtacttcagcgcgatcgccggctggacgctggacagcatctggcgc
taa

DBGET integrated database retrieval system