KEGG   Serratia sp. FGI94: D781_1925Help
Entry
D781_1925         CDS       T02433                                 

Definition
(GenBank) ATP-dependent phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
smaf  Serratia sp. FGI94
Pathway
smaf00010  Glycolysis / Gluconeogenesis
smaf00020  Citrate cycle (TCA cycle)
smaf00620  Pyruvate metabolism
smaf01100  Metabolic pathways
smaf01110  Biosynthesis of secondary metabolites
smaf01120  Microbial metabolism in diverse environments
smaf01130  Biosynthesis of antibiotics
smaf01200  Carbon metabolism
Module
smaf_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:smaf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D781_1925
   00020 Citrate cycle (TCA cycle)
    D781_1925
   00620 Pyruvate metabolism
    D781_1925
Enzymes [BR:smaf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     D781_1925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33 AAA_16
Motif
Other DBs
NCBI-ProteinID: AGB82211
UniProt: L0MHN9
Position
complement(2027864..2029483)
Genome map
AA seq 539 aa AA seqDB search
MSSTAVTPQTLARYGIHQASDIVYNPDYDLLFNEETRADLPPLERGTLTNLGAVAVDTGE
FTGRSPKDKYIVRDDVTRDTVWWSDSGTGKNDNQPMSPAVWQQLKTRVGDQLSGKRLFVV
DAFCGANADTRLKVRFITEVAWQAHFVKNMFIRPSDAELADFEPDFVVLNGAKCTNPDWQ
QQGLHSENFVAFNLTERMQLIGGTWYGGEMKKGMFSIMNYLLPLKGIASMHCSANVGEQG
DVAVFFGLSGTGKTTLSTDPKRQLIGDDEHGWDDDGVFNFEGGCYAKTIKLSPQAEPEIY
QAIRRDALLENVTVRADGSIDFDDGAKTENTRVSYPIYHIDNIVTPVSKAGHAQKIIFLT
ADAFGVLPPVSRLTPEQTQYHFLSGFTAKLAGTERGITEPTPTFSACFGAAFLTLHPTQY
AEVLVKRMQAAGAQAYLVNTGWNGSGKRISIKDTRGIIDAILNGEIEQADTFTLPIFGLA
VPTALPGVDPAILDPRKTYADASLWQEKAQDLAQRFIDNFAKYTVTPAGERLLAAGPQR
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcaaccgctgtaaccccgcaaacccttgcccgctacggtatccatcaggccagc
gatatcgtttacaaccctgactatgacctgctgtttaacgaagaaacccgcgccgacctg
ccgccgctggagcgcggcaccctaaccaacctcggcgcggtcgccgtcgataccggcgag
tttaccggccgttcgccgaaggataagtatattgtgcgtgacgacgtcacgcgcgacacc
gtctggtggtcagacagcggcaccggcaaaaacgacaaccagccgatgtcgccggcggtc
tggcagcagttgaaaacccgcgtgggcgatcagctgtccggcaagcgtctgtttgtggtt
gacgccttctgcggcgccaacgccgacacgcgcctcaaggtgcgctttatcaccgaggtc
gcctggcaggcgcacttcgtgaaaaacatgtttatccgcccgagcgatgccgagctggcg
gactttgagccggacttcgtggtgctgaacggcgccaaatgcaccaatccggactggcag
caacaggggctgcactcggaaaacttcgtcgccttcaacctgacggagcgtatgcagctg
atcggcggcacctggtacggcggcgaaatgaaaaagggcatgttctcgattatgaactac
ctgctgccgctgaagggcattgcctccatgcactgctcggccaacgtcggcgaacagggc
gacgtggcggtcttcttcggcctgtccggcaccggcaagaccacgctgtccaccgacccg
aaacgccagctgatcggcgatgacgaacacggctgggacgacgacggcgtgttcaacttc
gaaggcggctgctacgccaagaccatcaagctgtcgccgcaggccgagccggaaatttat
caggccattcgccgcgacgcgctgctggaaaacgtcacggtgcgcgccgacggcagcatt
gatttcgacgacggcgccaaaaccgagaacacccgcgtctcctacccgatttatcatatc
gacaatatcgtcacgccggtatccaaggccggtcacgcgcagaagatcatcttcctgacc
gccgacgccttcggcgtgctgccgccggtatcgcgcctgacgccggagcagacgcagtat
cacttcctgtctggcttcaccgccaaactggcgggcaccgagcgcggcatcaccgaaccg
acgccgaccttctccgcctgcttcggcgccgccttcctgacgctgcacccgacacagtac
gccgaagtgctggtgaaacgcatgcaggccgccggcgcacaggcctatctggtgaatacc
ggctggaacggcagcggcaagcgtatttccatcaaggatacgcgcggcattatcgacgcc
atcctcaacggcgagattgagcaggccgataccttcaccctgccgatcttcggcctggcg
gtgccaaccgcgctaccgggcgtcgacccggcgatcctcgacccgcgcaaaacctacgcc
gacgcgtcattgtggcaggaaaaagcgcaggatctggcgcagcgttttatcgacaacttc
gccaaatataccgtcaccccggcgggagaacgcctgctggccgccggcccgcagcgctaa

DBGET integrated database retrieval system