KEGG   Serratia marcescens FGI94: D781_2166Help
Entry
D781_2166         CDS       T02433                                 

Definition
(GenBank) dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase like protein
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
smaf  Serratia marcescens FGI94
Pathway
smaf00670  One carbon pool by folate
smaf00790  Folate biosynthesis
smaf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    D781_2166
   00670 One carbon pool by folate
    D781_2166
Enzymes [BR:smaf01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     D781_2166
    1.5.1.50  dihydromonapterin reductase
     D781_2166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NmrA GDP_Man_Dehyd NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: AGB82437
UniProt: L0MGN0
Position
complement(2281944..2282666)
Genome map
AA seq 240 aa AA seqDB search
MEPHDSAPVLITGGARRIGLALARSLLQRQVPVIVAYRSDYPALAELKSLGATCIQADFS
THDGIYQFAEQVREIAPKLRALVHNASAWQAESPYTPPEQVMASMLQIHVYTPYLLNQLL
EPCLRGQGQAGADIIHLTDYVVEKGSDKHIAYAASKAALDNMTRSFARKLAPEVKVNAIA
PALIIFNPGDDEAYRQQALQKSLMKVAPGESEVVELVHYLLGSRYVTGRTHGVDGGRPLR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggaaccccatgactctgcgccggtgctgatcaccggtggcgcccgccgcataggcctg
gcgttggcccgttcgctgctgcagcgccaggtaccggtgatcgtcgcctaccgcagcgac
tatccggcgctcgccgagcttaaatcactgggcgccacctgtattcaggccgatttctcc
acccacgacggcatctatcagtttgccgaacaggtgcgggaaatcgcccctaaactgcgg
gcgctggtgcataacgccagcgcctggcaggccgaatcgccgtatacgccgccggagcag
gtgatggcgtcgatgctgcaaatccacgtttacaccccctatctgctcaaccaactgcta
gagccttgcctgcgcggtcagggacaggccggcgccgatattatccatctgacggattac
gtggtggaaaaaggcagcgacaagcatatcgcttacgccgccagcaaggcggcgctggat
aacatgacccgttcgttcgcccgcaagctggcgccggaagtgaaggtcaacgccattgcg
ccggcgctgattatctttaaccccggcgacgatgaagcctatcgccagcaggcgctgcaa
aagtcgctgatgaaagtcgcccccggcgaaagcgaagtggtcgaactggtgcactacctg
ctcggcagccgctatgtgaccggccgcacccacggcgtcgacggcggccgtccgctgcgc
tga

DBGET integrated database retrieval system