KEGG   Serratia sp. FGI94: D781_2363Help
Entry
D781_2363         CDS       T02433                                 

Definition
(GenBank) cytochrome c peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
smaf  Serratia sp. FGI94
Brite
KEGG Orthology (KO) [BR:smaf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    D781_2363
Enzymes [BR:smaf01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     D781_2363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Haem_bd Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-ProteinID: AGB82630
UniProt: L0MIR2
Position
2502312..2503682
Genome map
AA seq 456 aa AA seqDB search
MKKIILGCAILAIAGYLGIVGYIYHYDQQRQPATADSDINTILTKHGCDYCHTQSAELPF
YASLPVAKQLMQYDIKTGSRHFDLNPTLNALRQDGAVPEVDLAKMEAVLQSGEMPPLRYK
AVHWSGELGDADRQTLLNWIRAQRERFYTRPGTPEALRGQALQPLPESLPTDAQKVALGF
RLFHDPRLSADNSISCAHCHQLGAGGVDGRVTSLGVNDQHGPINAPTVFNAALNFSQFWD
GRAADLQQQAGGPPLNPIEMASTSWEQIIGKLDQDARLKADFQRVYADGFSGDNITDAIA
EFEKTLLTPDSPFDRYLKGDDSALTAQQKRGYQLFRDNKCGTCHTGENLGGQSYEVMGLK
ADYFADRGNLTEADNGRYNVTKNEADRHRFKTPTLRNVALTAPYFHDGSVTSLHQAVKDM
LKYQVGVTLPDSDVDDLVALLDGMTGKYQPSAPPAN
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattattttggggtgtgcgatcctggcgatcgcggggtatcttggcatcgtc
ggttatatctatcactacgatcagcagcgtcagccggcaactgccgatagtgacatcaac
accattctcaccaaacacggctgcgattactgccacacccaatccgccgaactgcccttc
tacgccagcctgccggtggccaagcagctgatgcagtacgatatcaaaaccggttcgcgt
catttcgacctgaacccgaccctgaacgcgctgcgccaggacggtgcggtgccggaagtg
gacctggcgaaaatggaagcggtgctgcaaagcggcgaaatgccgccgctgcgttataaa
gcggtgcactggtccggtgagctgggcgatgccgaccggcagaccctgctgaactggatc
cgcgcccagcgtgaacgcttctatacgcgtccgggcacgccggaagcgctgcgcggtcag
gcgctgcagccgctgccggaatcgctgccgaccgacgcgcaaaaggtagcgctgggcttc
cgcctgttccacgacccgcgtctgtccgccgataacagcatctcctgcgcccactgtcac
caactgggcgccggcggcgttgacggccgcgtcacctcgctcggggtcaacgatcagcac
ggcccgatcaacgcgccgacggtgtttaacgccgcgctgaacttctctcagttctgggac
ggccgcgccgcggatttacagcagcaggccggcggaccgccgctcaacccgattgagatg
gcctccacctcctgggagcagattattggcaagctggaccaggacgcgcgcctgaaggcg
gatttccaacgcgtttacgccgacggtttctccggcgataacattaccgacgccatagcc
gagtttgaaaaaacgctgctgacgccggacagcccgttcgaccgctacctgaaaggcgac
gacagcgcgctgaccgcccagcaaaagcgcggttatcagctgttccgcgacaacaagtgc
ggcacctgtcataccggcgagaacctcggtggccagtcgtatgaagtgatgggcctgaaa
gccgactacttcgccgaccgcggcaacctgaccgaggccgacaacggtcgttacaacgtc
actaaaaatgaagccgatcgccaccgcttcaagacgccgaccctgcgcaacgtcgcgctg
accgccccgtacttccacgacggcagcgtcaccagcctgcaccaggcggtgaaggatatg
ctgaagtaccaggtcggcgtaacgctgcctgacagcgacgtcgacgacctggtcgcgctg
ctggacggcatgaccggcaaatatcagccgtcggccccgccggcgaactaa

DBGET integrated database retrieval system