KEGG   Serratia sp. FGI94: D781_2777
Entry
D781_2777         CDS       T02433                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
smaf  Serratia sp. FGI94
Brite
KEGG Orthology (KO) [BR:smaf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smaf02044]
    D781_2777
Secretion system [BR:smaf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   D781_2777
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AGB83028
UniProt: L0MGM1
Position
2927387..2927926
AA seq 179 aa
MANSKSRSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVMADLVGKPVDPQPSVD
ERKFLDIDIDNFDERMKSLKPRVAYQVDNTLTGEGKLNIDLSFESMDDFSPAAIARKVDS
LDGLLEARTQLSNLLSYMDGKNGAEELISQILQNPELLKSLTNAPKPAEPKDDNNERED
NT seq 540 nt   +upstreamnt  +downstreamnt
atggcaaactcgaaatcccgcagcggacagaagttcatcgcccgcaaccgcgcgccgcgc
gtccagattgaatatgatgtcgaaatctacggtgcagaacgcaaaattcagctgccgttt
gtaatgggtgtgatggcggatttggtcggtaaaccggtagacccgcagccgagcgtcgac
gagcgcaagttcctcgacatcgacatcgacaacttcgacgagcgtatgaagtcgttgaag
ccgcgcgtggcctaccaggtagacaataccctgaccggtgaagggaaactgaatatcgat
ctgtcctttgaaagcatggacgatttctcccctgccgccatcgcccgcaaagttgactca
ctggacggcctgctggaagcacgcacccagctgtccaacctgctttcctatatggacggt
aaaaacggcgccgaagagctgatctcccagatcctgcaaaatccggagctgttgaaatct
ctgactaacgcgccgaaaccggcagagccaaaagacgacaataacgagcgtgaggattaa

DBGET integrated database retrieval system