KEGG   Serratia sp. FGI94: D781_2778
Entry
D781_2778         CDS       T02433                                 

Definition
(GenBank) type VI secretion protein, EvpB/VC_A0108 family
  KO
K11900  type VI secretion system protein ImpC
Organism
smaf  Serratia sp. FGI94
Brite
KEGG Orthology (KO) [BR:smaf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smaf02044]
    D781_2778
Secretion system [BR:smaf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   D781_2778
SSDB
Motif
Pfam: VipB VipB_2 DUF1877 S_100
Other DBs
NCBI-ProteinID: AGB83029
UniProt: L0MGK0
Position
2927930..2929435
AA seq 501 aa
MSNSPQQQQALQTSETLSNDEFSALLNKEFRPKTDQAKEAVANAVKTLAQQALENTVTVS
SDAYRTIQALIAEIDEKLSQQINKIIHHEDFQKLEGAWHGLHYLVNNSETDELLKIRFMS
ISKKELGRTLKRHKGVGWDQSPIFKKIYEEEYGQFGGEPFGCLVGDYYFDHSPQDVELLG
EMAKISAASHCPFIAGTAPSVMQMESWQELSNPRDLTKIFQNTEYAAWRSLRESEDARYL
GLVMPRFLARLPYGIRTNPVDEFDFEEDTDGATHGNYTWTNAAYAMATNINRSFKEYGWC
TAIRGVESGGAVENLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGFMPLVHRKNSD
FAAFIGAQSLQKPAEYYDADASANAQLSARLPYLFACCRFAHYLKCIVRDKIGSFRERDD
MERWLNDWIMNYVDGDPANSSQETKSRKPLAAAEVQVEEIEDNPGYYSAKFFLRPHYQLE
GLTVSLRLVSKLPSLKKNDAS
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgagcaactcgcctcagcaacaacaagcgttacaaaccagcgaaaccttatccaacgac
gagttcagcgcgctgttgaacaaagagtttcgtccgaagaccgatcaggcgaaagaagcc
gtcgccaacgcggtgaaaaccctggcgcagcaggcgctggaaaacaccgtgaccgtatcc
tccgacgcttaccgcaccattcaggcgttgatcgcggagattgacgagaagctgtcgcag
caaatcaacaaaatcattcaccatgaagatttccagaagctggaaggcgcctggcacggc
ctgcactatctggtcaacaactcggaaaccgacgagctgctgaaaatccgctttatgagc
atctcgaagaaagagctgggccgcacgctgaagcgccacaagggcgtgggctgggaccaa
agcccgatcttcaagaaaatctatgaagaagagtacggccagttcggcggcgagccgttc
ggctgcctggtgggcgactactacttcgaccacagcccgcaggacgttgaactgctgggc
gaaatggccaagatcagcgccgcgtcgcactgcccgttcatcgccggcaccgcgccaagc
gtgatgcagatggaatcctggcaggagctgtccaatccgcgcgatctgaccaagatcttc
cagaataccgaatacgccgcttggcgcagcctgcgcgaatcggaagacgcccgctacctg
ggcctggtgatgccgcgcttcctggcgcgcctgccttacggcatccgcaccaacccggtt
gacgaatttgacttcgaagaagataccgacggcgcgacgcacggcaactacacctggacc
aacgccgcctatgcgatggcgaccaacatcaaccgctccttcaaagagtacggctggtgt
accgcaatccgcggggtggaatccggcggcgccgtagagaacctgccgtgccataccttc
ccgagcgacgacggcggcgtggatatgaagtgcccgaccgaaatcgccatcagcgaccgt
cgcgaggcggaactggcgaaaaacggctttatgccgctggtacaccgcaagaactccgac
tttgccgcctttatcggcgcccagtcgctgcagaagccggcggaatactacgacgccgac
gcctcggccaacgcccagctgtccgcacgcctgccgtacctgttcgcctgctgccgcttt
gcacattacctgaagtgcatcgtgcgcgacaaaatcggttccttccgcgagcgcgacgat
atggaacgctggctgaacgactggatcatgaactacgtggacggcgacccggccaactcc
tcgcaggaaaccaaatcccgcaaaccgctggccgcggcggaagttcaggtggaagagatc
gaagacaacccgggctactacagcgccaagttcttcctgcgtccgcattaccagctggaa
ggcctgaccgtttccctgcgtctggtgtcgaaactgccttcgctgaagaaaaacgacgcg
tcctga

DBGET integrated database retrieval system