KEGG   Serratia marcescens FGI94: D781_3276Help
Entry
D781_3276         CDS       T02433                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
smaf  Serratia marcescens FGI94
Pathway
smaf00300  Lysine biosynthesis
smaf01100  Metabolic pathways
smaf01120  Microbial metabolism in diverse environments
smaf01230  Biosynthesis of amino acids
Module
smaf_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    D781_3276
Enzymes [BR:smaf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     D781_3276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M18 Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AGB83500
UniProt: L0ML81
Position
3449035..3450162
Genome map
AA seq 375 aa AA seqDB search
MICPVIDLAQQLIRRPSLSPHDEGCQAMLIERLTAIGFTVEQMDFEDTQNFWAWRGEGET
LAFAGHTDVVPSGDESRWDNPPFEPTIRGGMLYGRGAADMKGSLAAMVVAAERFVAANPD
HRGRLAFLITSDEEASATHGTVKVVEALMARNERLDYCLVGEPSSTDRVGDVVKNGRRGS
ITANLHIHGVQGHVAYPHLADNPVHRAMPALNELVSIEWDRGNDYFPPTSMQIANIQAGT
GSNNVIPGELFVQFNFRFSTELTDALIKQRVEELLERHQLNYSIEWRLSGQPFLTPRGAL
VDAVVNAVEYYAELTPQLLTTGGTSDGRFIAQMGAQVVELGPVNATIHKINECVNAADLQ
QLSRMYQRIMEQLIA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgatttgccccgtaatcgatctggcgcaacagttaatccgccgcccttccctcagcccg
catgacgaaggctgccaggcgatgctgattgagcgcctgacggctatcggctttaccgtc
gagcagatggatttcgaagatacgcaaaatttctgggcctggcgcggtgaaggcgaaacg
ctggcgtttgccggccataccgacgtggtgccgagcggtgatgaaagccgctgggacaac
ccgccgtttgagccgaccatccgcggcggcatgctgtacggccgcggcgcggccgatatg
aaaggttcgctggcggcgatggtggtcgcggccgagcgcttcgtcgccgctaaccctgac
catcggggacggctggcgtttctcatcacctctgacgaagaggccagcgccacccacggc
acggtaaaagtggttgaagcgctgatggcgcgcaacgaacgtctggactactgcctggtc
ggcgagccgtccagcaccgaccgcgtcggcgatgtggtgaaaaacggccgtcgcggctcc
atcaccgccaacctgcatattcacggcgtacagggccacgtcgcctatccgcatctggcg
gacaacccggtgcaccgcgccatgccggcgctgaatgagctggtgagcatcgaatgggac
cgcggcaacgactacttcccgccgaccagcatgcagatcgccaatatccaggccggcacc
ggcagcaacaacgtcatccccggtgaactgtttgtccagtttaatttccgtttcagcacc
gaactgaccgacgccctcatcaaacagcgggtcgaagagctattggagcgtcatcagcta
aactacagtattgaatggcgtctttccggccagccgttcctcaccccgcgcggcgcgctg
gtggatgcggtggtcaacgccgttgaatattatgccgagctgacgccgcagctgctgacc
accggcggcacctccgacgggcgctttatcgcccagatgggcgcgcaggtggtggaactg
gggccggtcaacgccaccatccacaaaatcaacgaatgcgtgaacgccgccgatctgcag
cagctcagccggatgtatcagcgcattatggagcaactgatcgcatga

DBGET integrated database retrieval system