KEGG   Serratia sp. FGI94: D781_3535Help
Entry
D781_3535         CDS       T02433                                 

Definition
(GenBank) 23S RNA-specific pseudouridylate synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
smaf  Serratia sp. FGI94
Brite
KEGG Orthology (KO) [BR:smaf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:smaf03016]
    D781_3535
Enzymes [BR:smaf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     D781_3535
Transfer RNA biogenesis [BR:smaf03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    D781_3535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 DUF5492 RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: AGB83744
UniProt: L0MII7
Position
complement(3731631..3732401)
Genome map
AA seq 256 aa AA seqDB search
MLEILYQDEHLVAVNKPAGWLVHRSWLDRHESVFVMQTVRDQIGQHVFTVHRLDRPTSGV
LLMALSSEVAHLLSQQFEQHQVQKTYHAVVRGFVNDAATLDYQLTQKRDKIADKFSDADK
APQPALTHYRPLAQVEMPVAIGRYDSARYTLMELQPETGRKHQLRRHMTHLRHPIIGDSK
HGDLRQNRGMAQHFSCPRLMLHASHLRLNHPVSGQPLQISARWDQTWQGVMSQFGWLELV
PELVRVEFPAAYGQAS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaattctttatcaggacgagcatctggtggcggtgaataaacccgccggctgg
ctggtgcaccgcagctggctggaccgccatgagagtgtatttgtcatgcagacggtgcgc
gatcagatcggccagcatgtctttaccgttcaccggctcgatcggccgacgtccggcgtg
ctgctgatggcgctgtccagcgaggtcgcccatctgttgtcacagcagtttgaacagcat
caggtgcagaaaacctaccatgcggtggtgcgcggttttgtcaacgacgcggcgacgctg
gattatcagctgacgcagaagcgggacaagatcgccgataaattttctgatgcggataaa
gcgccgcagccggcgctgacccactatcggccactggcgcaggtggaaatgccggtggcg
atcgggcgctatgacagcgcgcgctacacgctgatggagctgcagccggagaccggtcgt
aaacatcagctgcggcgccatatgacgcacctgcgccacccgatcatcggcgacagcaag
catggcgatctgcggcagaaccgcggtatggcgcagcacttttcctgcccgcgtctgatg
ctgcacgccagccatctgcggcttaatcacccggtaagcgggcagccgctgcagatttcc
gcccgctgggaccagacctggcagggggtaatgtcacagtttggctggctggagcttgtc
cctgagcttgtcagggttgagtttccggcggcttacggtcaagctagctaa

DBGET integrated database retrieval system