KEGG   Serratia marcescens FGI94: D781_4205Help
Entry
D781_4205         CDS       T02433                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
smaf  Serratia marcescens FGI94
Pathway
smaf00010  Glycolysis / Gluconeogenesis
smaf00071  Fatty acid degradation
smaf00350  Tyrosine metabolism
smaf00625  Chloroalkane and chloroalkene degradation
smaf00626  Naphthalene degradation
smaf01100  Metabolic pathways
smaf01110  Biosynthesis of secondary metabolites
smaf01120  Microbial metabolism in diverse environments
smaf01130  Biosynthesis of antibiotics
smaf01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D781_4205
  Lipid metabolism
   00071 Fatty acid degradation
    D781_4205
  Amino acid metabolism
   00350 Tyrosine metabolism
    D781_4205
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    D781_4205
   00626 Naphthalene degradation
    D781_4205
Enzymes [BR:smaf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     D781_4205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C CoA_binding Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AGB84390
UniProt: L0MNJ7
Position
4443436..4444449
Genome map
AA seq 337 aa AA seqDB search
MKAAVVNQDHSVGIVDKQLRPLEHGEALLSMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVKAVGPGVSSLKVGDRASVAWFYQGCGHCEYCNSGNETLCRAVKNAGYSVDGGMAEE
CIVVADYAVKVPDGLDPAAASSITCAGVTTYKAVKISGIAPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDAQLTFASEMGADLVINSRTEDAAQIIQDKVQGAHAAVVTAVAKA
AFNSAVDAMRAGGRIVAVGLPPESMSLNIPRLVLDGIQVVGSLVGTREDLKEAFQFAAEG
KVVPTVTKRPVEDINAIFQEMEQGKIKGRMVIDFQSR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcggttgttaatcaggatcactcggtcggcatcgtggataaacagctgcgc
ccgctggagcacggcgaggcgctgctcagcatggagtgctgcggcgtctgccataccgat
ctgcacgtcaaaaacggtgatttcggcgacaagaccggcgttatcctcgggcatgaaggc
atcggtgtggtaaaagcggtcggccccggcgtcagttcgctgaaggttggcgaccgcgcc
agcgtcgcctggttttaccagggctgcgggcactgtgaatactgcaacagcggcaatgaa
accctgtgccgcgcggtgaagaacgccggctacagcgtggacggcgggatggcggaagag
tgcatcgtggtggccgactatgcggtaaaagtgccggacgggctggatccggcggccgcc
agcagcattacctgcgccggcgtcaccacctacaaggcggtgaaaatatcgggcattgcg
cccggccagtggatcgccatttacggcctgggcggcctcggcaacctggcgctgcagtat
gcgaaaaacgtctttaacgccaaggtgatcgccattgacgtcaatgacgcccaactgaca
ttcgccagcgaaatgggcgccgatctggtgattaactcccgcacggaagacgcggcgcag
attatccaggataaggttcagggcgcgcacgccgcggtggtcaccgcggtcgccaaagcg
gcgtttaactcggcggtggacgccatgcgcgccggcggccgcatcgtcgccgtcgggctg
ccgccggagtcgatgagcctgaatattccacggctggtactggacggtatccaggtggtc
ggctcgctggtcggcacccgcgaagatttaaaagaggcgtttcagtttgccgccgagggc
aaggtggtgcccaccgtgaccaagcgtccggtagaggatatcaacgccattttccaggag
atggaacagggcaagattaaaggccgcatggtgatcgacttccagtcccgctga

DBGET integrated database retrieval system