KEGG   Serratia sp. FGI94: D781_4508Help
Entry
D781_4508         CDS       T02433                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
smaf  Serratia sp. FGI94
Pathway
smaf00770  Pantothenate and CoA biosynthesis
smaf01100  Metabolic pathways
Module
smaf_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:smaf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    D781_4508
Enzymes [BR:smaf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     D781_4508
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     D781_4508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: AGB84671
UniProt: L0MPL4
Position
4748395..4749609
Genome map
AA seq 404 aa AA seqDB search
MTGLSGKHIVLGISGGIAAYKCPELVRRLRDRGAEVRVVMTQAAQSFITPLTLQAVSGYP
VSDDLLDPAAEAAMGHIELGKWADLVILAPATADLLARVAAGMANDLLTTLCLATAAPIA
AAPAMNQQMYRAAATQANLRTLQARGMLMWGPDSGSQACGDVGPGRMLDPLELVDLANRH
FSTPQDLTHLKLMVTAGPTREALDPVRFISNHSSGKMGFAIATAAAARGAQVTLIAGPVD
LPTPPSVTRIDVISALEMERAVQQQAAQQDIFVSCAAVADYRPALVADEKIKKQGDEITI
KMVKNPDIVAGVAAMNKNRPFVVGFAAETQNVEEYARQKLARKKLDVICANDVSLAGQGF
NSDTNALHLFWQDGEKRLALSDKALLGQRLIDEIVSRYDEKNRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgacgggactttccggcaaacatatcgtactgggcatcagcggcggcatcgcggcgtat
aaatgcccggagctggtgcgccgcctgcgcgacagaggcgccgaagtacgcgtagtgatg
acccaggctgcgcagtcgttcattaccccgctgacgctgcaggcggtttccggctatccg
gtgtcggacgatctgctggatcccgccgcagaggccgccatgggccatatcgagctgggc
aagtgggccgatctggtgattctggcgccggcaacggcagatttgctggcgcgcgtcgcc
gccggcatggccaacgacctgctcaccaccctgtgcctggcgacggccgcccccatcgcc
gccgcgccggcgatgaaccaacagatgtaccgcgccgcggcgacgcaggccaacctgcgc
accctgcaggcgcgcggcatgctgatgtgggggccggacagcggcagccaggcctgcggc
gacgtcggcccgggccggatgcttgatccgctggagctggtcgatctggcgaaccgccac
ttctcaacgccgcaggacctcacgcacctgaagctgatggtcaccgccggcccgacgcgt
gaggcgctggacccggtgcgctttatcagcaaccacagctcgggcaaaatgggctttgcc
atcgccaccgccgccgcggcgcgcggcgcgcaggtcacgctgatcgccgggccggtggat
ctgccgaccccgccgtcggtgacgcgcatcgacgtcatcagcgcgctggagatggagcgg
gccgtgcagcagcaggcggctcagcaggatatttttgtctcctgcgccgccgtggcggat
taccgccctgcgctggtggccgatgaaaaaattaaaaaacagggtgatgagatcaccatc
aagatggtaaaaaaccccgacatcgtcgccggcgttgccgccatgaacaaaaatcgaccg
tttgtcgttgggtttgctgccgaaacccagaatgtggaagaatacgcgcgacaaaaactg
gcgcgcaagaaactggatgtaatctgcgccaacgatgtatcgcttgcagggcagggtttc
aacagtgataccaatgccttacaccttttttggcaggatggggaaaagcgcctggcgctt
agcgataaagctctccttggccaacgtttaatagacgagatagtcagccgttatgatgaa
aaaaatcgacgttaa

DBGET integrated database retrieval system