KEGG   Sphingopyxis macrogoltabida EY-1: AN936_10580Help
Entry
AN936_10580       CDS       T04104                                 

Definition
(GenBank) 1,4-beta-D-glucan glucohydrolase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
smag  Sphingopyxis macrogoltabida EY-1
Pathway
smag00460  Cyanoamino acid metabolism
smag00500  Starch and sucrose metabolism
smag01100  Metabolic pathways
smag01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AN936_10580
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    AN936_10580
Enzymes [BR:smag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     AN936_10580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Exop_C Glyco_hydro_3_C DMSP_lyase
Motif
Other DBs
NCBI-ProteinID: ALH80798
UniProt: A0A0N9UB44
Position
complement(2220648..2223134)
Genome map
AA seq 828 aa AA seqDB search
MRRQAMAVASMLLLAGTALATAPEQVGTEAAAVHSELWPAAKSPAAITDPKTEAAIDALI
AKMTVEQKVGQLVQGDISTITPKDLETYPLGSILAGGNSGPNGNERSSAADWAKLVGEFR
AVSLRPQANGVAIPIIFGVDAVHGHNNIPGATLFPHNIGLGAARDPELIQRIGAVTAAEI
AGSGIEWTFAPTLAVPQDLRWGRSYEGYAADPKLIAKYAKAMVLGLQGPLVAGKTVDATH
VAATAKHFLADGGTFEGRDQGDAKVDEKELIAKHAQGYPAAIDAGALTVMASFSSWQGIK
HHGNKGLLTDALKDRMGFEGFVVGDWNGHGQVAGCSVTDCAQSINAGLDMFMAPDSWKGL
YETTLAQAKDGRIAAARLDDAVRRILRVKYKLGLFDAGHGSRGDFAAVGAPAHLEVAREA
VAKSLVLLKNNGSVLPIKPGAKLLVAGPGADNMAMQSGGWTISWQGTDVTHADFPNGQTI
WEALNKAVGEAGGKATLSADGSFTEKPDVAIVVFGEEPYAEFQGDVPTLDYQPAEAKDLA
TLKKLKAAGIPVVALFLSGRPLFTNPEINAADAFVAGWLPGSQAVGVADVLVAGKDGKTA
RGFTGKLPFAWPADARSPFEKPQFAVGYGLAYGDKTAVPQLPEAPGVDIAGMLNVEKYFS
GGRARAPWTLSIVDAGGSRQVGSAPVDSSYGLLKTRSVDVKAQEDGKSFVWSGPASFTLA
GPNADLSRQLNNSFALRLDWRVDAVGQGPVSIALGGPAFDISALVSAAPKGQVSTIKLPL
RCFADGGADLTRVAHAVTLGGDKGLAVTLLNANVEAVGENLPCPPAAK
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgacaggcgatggctgtggcgagcatgctgctgttggcaggcaccgcactggcg
acggcgccggagcaggtgggcaccgaggccgcggccgtacattccgaactctggcccgcc
gccaagagtcccgccgcgatcaccgatcccaagaccgaagcggcgatcgatgcgctgatc
gcgaagatgacggtcgagcagaaggtcggccagctcgtgcagggcgacatcagcacgatt
acgccgaaggatctcgaaacctatccgctcggttcgatcctcgcgggcggcaacagcggc
cccaatggcaatgagcggtcgagcgcggccgactgggcgaagctcgtcggcgagtttcgc
gcggtgtcgctgcgcccgcaggcgaacggcgtggcgatcccgatcatcttcggcgtcgat
gccgtccacggacataataatattcccggcgcgacgctgtttccgcacaacatcgggctc
ggcgcggcgcgcgatcccgaattgatccaacggatcggcgcggtcacagctgcggagatc
gcgggtagcggcatcgaatggaccttcgcgccgacgcttgcggtcccgcaggacctgcgc
tggggccgcagctatgaaggctatgccgccgacccaaaactgatcgcgaaatatgccaag
gccatggtgctcggcctgcaggggccactggtcgccggaaagactgtcgatgcgacgcac
gtcgcggcgacggccaagcatttccttgccgatggcgggacgttcgagggtagggaccag
ggcgacgccaaggtcgacgaaaaggagctgattgccaagcacgcacagggctatccggcg
gcgatcgatgccggggcgctgaccgtcatggcgagcttttcgagctggcagggaatcaag
caccacggcaacaagggtctgctgaccgacgcgctcaaggacaggatgggctttgaaggg
tttgtcgtcggcgactggaacggtcatggtcaggtcgccggatgcagcgtcaccgattgc
gcccagtcgatcaacgccgggctcgacatgttcatggcgcccgatagctggaaggggctg
tacgagacgacgctggcgcaggcgaaggatggccggattgccgcagcgcggctcgacgat
gcggtgcggcgcatcctgcgggtgaaatacaagctcgggctgttcgacgccgggcatggc
agccgcggcgattttgccgccgtgggcgcgcccgcgcatctcgaagtcgcgcgcgaagcg
gtcgccaaatcgctggttctgctcaagaataatggcagcgtgttgccgatcaaacccggc
gcgaagctgctcgtcgcggggcctggcgccgataatatggcgatgcagtcgggtggctgg
acgatcagttggcagggaaccgacgtgacccacgccgactttccgaacgggcagacgatc
tgggaagcgttgaacaaggcggtcggcgaggcgggcggcaaggcgacgctctcggccgac
ggcagcttcaccgaaaagcccgatgtcgcgatcgtcgtgttcggcgaggagccttatgcc
gaattccagggcgacgtcccgacactcgactatcagccggcggaagcgaaagacctcgcg
acgctgaagaagctgaaggcggcgggtatcccggtcgttgcgctgttcctgtcggggcgg
ccgttgttcaccaaccctgagatcaatgccgccgacgcctttgtcgcgggctggttgccc
ggatcgcaggcggtgggggtggccgatgtcctggttgcgggcaaggacggcaagacggcg
cgcggctttaccggcaagctgcccttcgcctggcccgccgacgcgcgatcgccgttcgaa
aagccgcagttcgcggtcggttatgggctggcctatggtgacaagaccgcggtgccgcag
ctgcctgaagcgcccggcgtcgacatcgccggcatgctcaacgtcgagaaatatttcagc
ggcggccgcgcgcgggcgccgtggaccttgtcgatcgtcgacgcgggcggctcccggcag
gttggatcggcgccggtcgacagcagctatggcctgctcaaaacgcgctcggtcgacgtg
aaggcgcaggaagacggcaagagcttcgtctggagcggcccggcctcgttcaccttggcg
ggccccaacgccgacctgtcgcgccagctcaataacagcttcgcgctgcgtctcgactgg
cgcgtcgacgcggttgggcaggggccggtcagtatcgcgctcggcggcccggcgttcgac
atttctgcgctggtcagcgccgcgccgaaagggcaggtttcgacgatcaagctgccgctg
cgctgcttcgccgacgggggtgccgacctgacgcgcgtcgcccatgcggtgacgctcggc
ggcgacaaggggctggcagtgacgctgctgaatgcgaatgtcgaggcggtcggggagaat
ctgccctgtccgccagccgcgaaatga

DBGET integrated database retrieval system