KEGG   Sphingopyxis macrogoltabida EY-1: AN936_12010Help
Entry
AN936_12010       CDS       T04104                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
smag  Sphingopyxis macrogoltabida EY-1
Pathway
smag00071  Fatty acid degradation
smag00072  Synthesis and degradation of ketone bodies
smag00280  Valine, leucine and isoleucine degradation
smag00310  Lysine degradation
smag00362  Benzoate degradation
smag00380  Tryptophan metabolism
smag00620  Pyruvate metabolism
smag00630  Glyoxylate and dicarboxylate metabolism
smag00640  Propanoate metabolism
smag00650  Butanoate metabolism
smag00900  Terpenoid backbone biosynthesis
smag01100  Metabolic pathways
smag01110  Biosynthesis of secondary metabolites
smag01120  Microbial metabolism in diverse environments
smag01130  Biosynthesis of antibiotics
smag01200  Carbon metabolism
smag01212  Fatty acid metabolism
smag02020  Two-component system
Brite
KEGG Orthology (KO) [BR:smag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AN936_12010
   00630 Glyoxylate and dicarboxylate metabolism
    AN936_12010
   00640 Propanoate metabolism
    AN936_12010
   00650 Butanoate metabolism
    AN936_12010
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AN936_12010
   00072 Synthesis and degradation of ketone bodies
    AN936_12010
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AN936_12010
   00310 Lysine degradation
    AN936_12010
   00380 Tryptophan metabolism
    AN936_12010
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AN936_12010
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AN936_12010
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AN936_12010
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smag04147]
    AN936_12010
Enzymes [BR:smag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AN936_12010
Exosome [BR:smag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AN936_12010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALH81066
UniProt: A0A0N9V0K0
Position
2524656..2525885
Genome map
AA seq 409 aa AA seqDB search
MAKDVFILGGAQTDFSRNLEREGGGLFELFRDVAEAAFVATGIEPKEVETAHVGNFVGEL
FAGQGQLGGFFGHVHPDLAGIPASRHEAACASGSIAILAAAAEIEAERYGLALVLGIELM
RNVPGQRAAEYLGAAAWAGREAQEARYLWPYMFARVAEEYEERFGLDRVHLRGISANNFA
NAKRNPNSQTRGWAVTDDHLGENDEVNPLIEGSLRKSDCGQVTDGAAAIFLASREVAETY
AKRRSIPLESIPRIKGWGHATAPLLYSTKVADSRGGDYVFPSVRKAMMDALRRAEMPDIY
ACDGVEVHDCFSITEYMAIDHFGITKPGESWRAVEDGTIALSGKLPVNPSGGLIGLGHPV
GATGVRMLLDSWRQVTGNAGDYQVEGAKNFATFNVGGSATTAVSFVVGT
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggacgtcttcatcctcggcggcgcgcagaccgatttttcgcgcaacctcgaa
cgcgaaggcggcggcttgttcgagctgtttcgcgacgttgccgaagcagcgttcgtcgcg
acggggatcgagcccaaggaagtcgagaccgcgcatgtcggcaatttcgtcggcgagctt
ttcgcgggacagggccagctcggcggcttcttcggtcatgtccaccccgacctcgcgggc
atccccgcatcgcgccacgaggccgcctgtgcgtcgggcagcatcgcgatcctcgccgcc
gcggcggaaatcgaagctgaacgctatggccttgcgctcgtgctcggcatcgaactgatg
cgcaacgttcccggccagcgcgccgccgaatatctcggcgccgcggcttgggctggccgc
gaggcgcaggaggcgcggtacctctggccgtatatgttcgcgcgcgttgccgaggaatat
gaggaacgcttcgggctcgaccgcgtgcatctgcgcggcatttcggccaataattttgcc
aatgccaagaggaacccgaactcgcagacccgcggctgggcggtgactgacgatcatctc
ggcgagaatgacgaggttaatccgctgatcgaaggttcgctccgcaagtccgattgcggg
caagtcaccgacggcgctgccgcgatcttcctcgcctcgcgtgaggtcgccgaaacatat
gcgaagcgccgcagtatccccttggagagcattccgcgcatcaagggctggggccacgcc
accgcgccgctgctctattcgaccaaggtcgcggacagccgcggcggcgactatgtcttc
ccgagcgtgcgcaaggcgatgatggacgcgctgcgccgcgccgagatgcccgacatctat
gcctgcgacggggtcgaggtgcacgactgtttctcgatcaccgaatatatggcgatcgac
catttcggcatcaccaagccgggcgaaagctggcgcgcggtcgaggacgggacgattgca
ttgagcggcaagctgccagtcaatccgtcgggcgggctgatcgggctggggcacccggtg
ggcgcgacgggggtgcgaatgctgctcgacagttggcggcaggtcaccgggaatgccggc
gattatcaggtcgaaggcgcgaagaatttcgcgaccttcaacgtcggcggcagcgcgacg
accgcggtcagcttcgtcgtcggcacgtga

DBGET integrated database retrieval system