KEGG   Sphingopyxis macrogoltabida EY-1: AN936_17370Help
Entry
AN936_17370       CDS       T04104                                 

Definition
(GenBank) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
smag  Sphingopyxis macrogoltabida EY-1
Pathway
smag00360  Phenylalanine metabolism
smag00400  Phenylalanine, tyrosine and tryptophan biosynthesis
smag00790  Folate biosynthesis
smag01100  Metabolic pathways
smag01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smag00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    AN936_17370
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AN936_17370
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AN936_17370
Enzymes [BR:smag01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     AN936_17370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ALH82062
UniProt: A0A0N9U9N4
Position
complement(3679507..3680376)
Genome map
AA seq 289 aa AA seqDB search
MKSPDTHVHQTPPPGSAPDWTCPQNWDAFSPDEHAMWDHLFARQSDMLPGRASDAFLRGI
DVLRLEKPGIPDYRELNARLVDATGWQVVAVPGLVPDEVFFDHLANRRFPAGNFIRTPEQ
LDYLQEPDVFHDVFGHVPMLADPVFADYMVAYGLGGLRSLKFDALKQLARLYWYTVEFGL
IREAGGLRIYGAGIVSSYAESIFALESDSPNRIGFDLARVMRTDYRIDDFQQNYFVIDSL
DQLLDTTVNTDLAPLYVENAALPPIPIADILPGDEVITRGTQDYAAAKA
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtcctgatacgcacgtccatcagacgccgccgccgggttccgcgccggactgg
acctgtccgcagaattgggatgccttttcgcccgacgaacatgcgatgtgggatcacctc
ttcgcgcgccagtcggacatgttgccggggcgcgcctccgacgctttcctgcgcgggatc
gacgtcctccggctcgaaaagcccggcattcccgattatcgcgaactcaatgcgcggctc
gtcgatgcaacggggtggcaggtcgtggcggtgccggggctggtgcccgacgaggtcttt
ttcgaccatctcgcgaaccggcgctttccagcgggcaatttcatccgcacccccgaacag
ctcgattatcttcaggagcccgacgtcttccacgacgtgttcggccatgtcccgatgctc
gccgacccggtgtttgccgactatatggttgcctatggcctcggcgggctgcgcagcctg
aaattcgacgcgcttaagcagctcgcgcgcctttactggtatacggtcgaattcggcttg
atccgcgaagctggcggcctgcgtatctacggcgccggcatcgtctcttcctatgccgag
agcatcttcgcgctcgagtcggacagcccgaaccgcatcggtttcgaccttgcgcgcgtc
atgcgcaccgattaccggatcgacgatttccagcagaattatttcgtcatcgacagcttg
gaccagcttctcgacacgacggtcaacaccgacttggcgccgctctatgtcgaaaacgcc
gcgctaccgccgatcccgatcgccgacatcctgcccggcgacgaggtgatcacgcgcggc
acgcaggactatgcggcggcgaaagcctag

DBGET integrated database retrieval system